KEGG   Homo sapiens (human): 56267Help
Entry
56267             CDS       T01001                                 

Gene name
KYAT3, CCBL2, KAT3, KATIII
Definition
(RefSeq) kynurenine aminotransferase 3
  KO
K00816  kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00380  Tryptophan metabolism
hsa00450  Selenocompound metabolism
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    56267 (KYAT3)
   00380 Tryptophan metabolism
    56267 (KYAT3)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    56267 (KYAT3)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    56267 (KYAT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    56267 (KYAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     56267 (KYAT3)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     56267 (KYAT3)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     56267 (KYAT3)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   56267 (KYAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Luciferase_N
Motif
Other DBs
NCBI-GeneID: 56267
NCBI-ProteinID: NP_001008661
OMIM: 610656
HGNC: 33238
Ensembl: ENSG00000137944
Vega: OTTHUMG00000010617
Pharos: Q6YP21(Tdark)
UniProt: Q6YP21 B4DW13
Position
1p22.2
AA seq 454 aa AA seqDB search
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggcccagaggagcctctgctctcttagcggtagagcaaaattcctgaagaca
atttcttcttccaaaatcctcggattctctacttctgctaaaatgtcactgaaattcaca
aatgcaaaacggattgaaggacttgatagtaatgtgtggattgaatttaccaaattggct
gcagacccttctgttgtgaatcttggccaaggctttccagatatatcccctcctacatat
gtaaaagaagaattatcaaagattgcagcaatcgatagcctgaatcagtatacacgaggc
tttggccatccatcacttgtgaaagctctgtcctatctgtatgaaaagctttatcaaaag
caaattgattcaaataaagaaatccttgtgacagtaggagcatatggatctctttttaac
accattcaagcattaattgatgagggagatgaagtcatactaatagtgcctttctatgac
tgctatgagcccatggtgagaatggctggagcaacacctgtttttattcccctgagatct
aaacctgtttatggaaaaagatggtctagttctgactggacattagatcctcaagaactg
gaaagtaaatttaattccaaaaccaaagctattatactaaatactccacataacccactt
ggcaaggtgtataacagagaggaactgcaagtaattgctgacctttgcatcaaatatgac
acactctgcatcagcgatgaggtttatgaatggcttgtatattctggaaataagcactta
aaaatagctacttttccaggtatgtgggagagaacaataacaataggaagtgctggaaag
actttcagtgtaactggctggaagcttggctggtccattggtccaaatcatttgataaaa
catttacagacagttcaacaaaacacgatttatacttgtgcaactcctttacaggaagcc
ttggctcaagctttctggattgacatcaagcgcatggatgacccagaatgttactttaat
tctttgccaaaagagttagaagtaaaaagagatcggatggtacgtttacttgaaagtgtt
ggcctaaaacccatagttcctgatggaggatacttcatcatcgctgatgtgtctttgcta
gatccagacctctctgatatgaagaataatgagccttatgactataagtttgtgaaatgg
atgactaaacataagaaactatcagccatccccgtttcagcattctgtaactcagagact
aaatcacagtttgagaagtttgtgcgtttttgcttcattaaaaaagacagcacactggat
gctgctgaagaaatcatcaaggcatggagtgtacagaagtcttga

DBGET integrated database retrieval system