KEGG   Homo sapiens (human): 56269
Entry
56269             CDS       T01001                                 

Gene name
IRGC, CINEMA, IFGGE, IRGC1, Iigp5, R30953_1
Definition
(RefSeq) immunity related GTPase cinema
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: IIGP MMR_HSR1 ABC_tran Dynamin_N RsgA_GTPase AAA_16 AAA_29 MeaB KAP_NTPase AAA_23
Other DBs
NCBI-GeneID: 56269
NCBI-ProteinID: NP_062558
HGNC: 28835
Ensembl: ENSG00000124449
Vega: OTTHUMG00000154587
Pharos: Q6NXR0(Tbio)
UniProt: Q6NXR0 J7NNX4
Position
19q13.31
AA seq 463 aa
MATSKLPVVPGEEENTILMAKERLEALRTAFESGDLPQAASHLQELLASTESIRLEVGVT
GESGAGKSSLINALRGLEAEDPGAALTGVMETTMQPSPYPHPQFPDVTLWDLPGAGSPGC
PADKYLKQVDFSRYDFFLLVSPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQ
RPSGFREAAVLQEIRDHCAERLREAGVADPRIFLVSNLSPARYDFPTLVSTWEHDLPSHR
RHAGLLSLPDISLEALQKKKAMLQEQVLKTALVLGVIQALPVPGLAAAYDDALLIHSLRG
YHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARA
FERGIPVFGTLVAGGISFGAVYTMLQGCLNEMAEDAQRVRIKALEDDEPQPEVSLEVASD
NGVEKGGSGEGGGEEAPLSTCRKLGLLLKYILDSWKKHDSEEK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggctacttcaaagttgcccgtggtgcctggggaggaggaaaacaccatccttatggcc
aaggaaaggctggaggccctgcgcacagcctttgagtcgggtgacctcccccaggccgcc
tctcacctccaggagctgctggcctccacggaaagcatccgcctggaggtgggcgtcacg
ggcgagtcgggcgcgggcaagtcctccctcatcaatgccctgcgtggcctggaggccgag
gaccctggcgcggctctcacgggcgtcatggagaccacgatgcaaccgtcgccctatcca
cacccacagttccctgacgtgaccctctgggacctgccaggagccggctctccaggctgc
ccggctgacaagtacctaaagcaggtagacttcagccgctatgacttcttcctgctggtc
tccccccgccgctgcggggccgtcgagacccgcctggccgctgagatcctgtgccagggc
aagaagttctactttgtgcgcaccaaggtggacgaggacctggcggccacgcgcacccag
cggccgtcgggcttcagagaggccgctgtcctgcaggagatccgagaccactgtgccgag
cggctgcgggaggccggcgtggctgaccctcgcatcttcctggtgtccaacctctcgccg
gcccgctacgactttcccacgctggtgtccacctgggagcacgacctgccctcccaccgg
cgccacgctggcctgctgtcgctccccgacatctcgctggaggccttgcagaagaagaag
gccatgcttcaagagcaagtcctcaagaccgccctggtgttgggcgtcatccaggccctg
ccggtcccagggctggcggccgcctacgatgatgcgttgctcatccactcactgcgtggc
taccaccgcagctttggtctggacgacgactcgctggccaagctggccgagcaggtgggc
aaacaggcaggtgacctgcgctcggtcatccgctccccactggccaacgaggtctcgcct
gagactgtcctgcggctctattcccagtcgtccgacggcgccatgcgggtggcccgcgcc
tttgagaggggcatccctgtgtttgggacgctggtggctggcggcatcagctttggcgct
gtctacaccatgctccagggctgcctcaacgagatggctgaggacgcccagcgtgtccgc
atcaaggccctggaggatgacgagccgcagccggaggtcagcttggaagtggccagtgac
aatggcgtggaaaaggggggctccggggagggaggtggggaggaagccccactctcaacc
tgcaggaagctcggcctccttcttaagtacattctggacagctggaagaaacacgactca
gaagagaaataa

DBGET integrated database retrieval system