KEGG   Homo sapiens (human): 56270
Entry
56270             CDS       T01001                                 

Gene name
WDR45B, NEDSBAS, WDR45L, WIPI-3, WIPI3
Definition
(RefSeq) WD repeat domain 45B
  KO
K22991  WD repeat-containing protein 45
Organism
hsa  Homo sapiens (human)
Disease
H02470  Neurodevelopmental disorder with structural brain abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56270 (WDR45B)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    56270 (WDR45B)
Motif
Pfam: ANAPC4_WD40 DUF5711 PHTB1_N DUF1513 WD40
Other DBs
NCBI-GeneID: 56270
NCBI-ProteinID: NP_062559
OMIM: 609226
HGNC: 25072
Ensembl: ENSG00000141580
Vega: OTTHUMG00000150146
Pharos: Q5MNZ6(Tdark)
UniProt: Q5MNZ6
Structure
PDB: 
6IYY

Position
17q25.3
AA seq 344 aa
MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEML
FRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMI
KVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVD
IPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQ
DASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICA
FGTEPNAVIAICADGSYYKFLFNPKGECIRDVYAQFLEMTDDKL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaacctcctgccgtgtaaccctcacggcaacgggctgctctacgccggcttcaaccag
gaccacggatgctttgcgtgtgggatggaaaatggattccgagtctataacactgatcca
ctaaaagaaaaagagaaacaagaatttctagaaggaggagttggccatgttgaaatgtta
tttcgctgcaactatttagctttagttggtggtggaaaaaagccgaaataccctcccaac
aaagtaatgatctgggatgacctgaagaagaagactgttattgaaatagaattttctaca
gaagtcaaggcagtcaagctgcggcgagatagaattgtggtggttttggactccatgatt
aaggtgttcacattcacacacaatccccatcagttgcacgtcttcgaaacctgctataac
cccaaaggcctctgtgtcctttgtcccaatagtaacaactccctcctggcctttccgggc
acgcacacgggccatgtgcagcttgtggacctggccagcacggagaagccacccgtggac
attcctgcacacgagggtgtcctgagctgcattgcactcaacctgcagggaacaagaatt
gcaactgcatccgagaaagggacgcttataagaatatttgatacttcatcagggcattta
atccaggaactgcgaagaggatctcaagcagccaatatttactgcatcaacttcaatcag
gatgcgtccctcatctgcgtatccagcgaccacggcacagtgcatatttttgcagctgaa
gatccaaaaaggaataaacagtccagtttggcctcagccagtttccttccaaaatacttc
agttccaagtggagtttctccaagtttcaggttccctcaggctctccgtgcatttgtgcc
tttggaacagagccaaacgccgtcattgcaatttgtgcagacggcagctactacaaattc
ctgttcaaccccaagggggagtgcatccgagatgtctacgcgcagtttctagagatgacc
gatgacaagctgtga

DBGET integrated database retrieval system