KEGG   Homo sapiens (human): 56287
Entry
56287             CDS       T01001                                 

Gene name
GKN1, AMP18, BRICD1, CA11, FOV, foveolin
Definition
(RefSeq) gastrokine 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BRICHOS ERbeta_N
Other DBs
NCBI-GeneID: 56287
NCBI-ProteinID: NP_062563
OMIM: 606402
HGNC: 23217
Ensembl: ENSG00000169605
Vega: OTTHUMG00000129574
Pharos: Q9NS71(Tbio)
UniProt: Q9NS71 Q53YU7
Position
2p13.3
AA seq 185 aa
MKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSW
NSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLM
YSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCG
DTVEN
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaagttcacaattgtctttgctggacttcttggagtctttctagctcctgccctagct
aactataatatcaacgtcaatgatgacaacaacaatgctggaagtgggcagcagtcagtg
agtgtcaacaatgaacacaatgtggccaatgttgacaataacaacggatgggactcctgg
aattccatctgggattatggaaatggctttgctgcaaccagactctttcaaaagaagaca
tgcattgtgcacaaaatgaacaaggaagtcatgccctccattcaatcccttgatgcactg
gtcaaggaaaagaagcttcagggtaagggaccaggaggaccacctcccaagggcctgatg
tactcagtcaacccaaacaaagtcgatgacctgagcaagttcggaaaaaacattgcaaac
atgtgtcgtgggattccaacatacatggctgaggagatgcaagaggcaagcctgtttttt
tactcaggaacgtgctacacgaccagtgtactatggattgtggacatttccttctgtgga
gacacggtggagaactaa

DBGET integrated database retrieval system