KEGG   Homo sapiens (human): 56288Help
Entry
56288             CDS       T01001                                 

Gene name
PARD3, ASIP, Baz, PAR3, PAR3alpha, PARD-3, PARD3A, PPP1R118, SE2-5L16, SE2-5LT1, SE2-5T2
Definition
(RefSeq) par-3 family cell polarity regulator
  KO
K04237  partitioning defective protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    56288 (PARD3)
   04390 Hippo signaling pathway
    56288 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56288 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    56288 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    56288 (PARD3)
   04530 Tight junction
    56288 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    56288 (PARD3)
  09158 Development
   04360 Axon guidance
    56288 (PARD3)
 09160 Human Diseases
  09167 Infectious diseases
   05165 Human papillomavirus infection
    56288 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    56288 (PARD3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    56288 (PARD3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56288 (PARD3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    56288 (PARD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3534 PDZ PDZ_2 TPR_11
Motif
Other DBs
NCBI-GeneID: 56288
NCBI-ProteinID: NP_062565
OMIM: 606745
HGNC: 16051
Ensembl: ENSG00000148498
Vega: OTTHUMG00000017948
Pharos: Q8TEW0(Tbio)
UniProt: Q8TEW0
Structure
PDB: 

Position
10p11.22-p11.21
AA seq 1356 aa AA seqDB search
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSP
VDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPS
YAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcggacggacccgggtggtcgtgccgtgcggggacggccac
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccatcgccaag
gatccaaactactggatacaggtgcatcgcttggaacatggagatggaggaatactagac
cttgatgacattctttgtgatgtagcagacgataaagacagactggtagcagtgtttgat
gagcaggatccacatcacggaggtgatggcaccagtgccagttccacgggtacccagagc
ccagagatatttggtagtgagcttggcaccaacaatgtctcagcctttcagccttaccaa
gcaacaagtgaaattgaggtcacaccttcagtccttcgagcaaatatgcctcttcatgtt
cgacgcagtagtgacccagctctaattggcctctccacttctgtcagtgatagtaatttt
tcctctgaagagccttcaaggaaaaatcccacacgctggtcaacaacagctggcttcctc
aagcagaacactgctgggagtcctaaaacctgcgacaggaagaaagatgaaaactacaga
agcctcccgcgggatactagtaactggtctaaccaatttcagagagacaatgctcgctcg
tctctgagtgccagtcacccaatggtgggcaagtggctggagaaacaagaacaggatgag
gatgggacagaagaggataacagtcgtgttgaacctgttggacatgctgacacgggtttg
gagcatatacccaacttttctctggatgatatggtaaagctcgtagaagtccccaacgat
ggagggcctctgggaatccatgtagtgcctttcagtgctcgaggcggcagaaccctgggg
ttattagtaaaacgattggagaaaggtggtaaagctgaacatgaaaatctttttcgtgag
aatgattgcattgtcaggattaatgatggcgaccttcgaaatagaagatttgaacaagca
caacatatgtttcgccaagccatgcgtacacccatcatttggttccatgtggttcctgca
gcaaataaagagcagtatgaacaactatcccaaagtgagaagaacaattactattcaagc
cgttttagccctgacagccagtatattgacaacaggagtgtgaacagtgcagggcttcac
acggtgcagagagcaccccgactgaaccacccgcctgagcagatagactctcactcaaga
ctacctcatagcgcacacccctcgggaaaaccaccatccgctccagcctcggcacctcag
aatgtatttagtacgactgtaagcagtggttataacaccaaaaaaataggcaagaggctt
aatatccagcttaagaaaggtacagaaggtttgggattcagcatcacttccagagatgta
acaataggtggctcagctccaatctatgtgaaaaacattctcccccggggggcggccatt
caggatggccgacttaaggcaggagacagacttatagaggtaaatggagtagatttagtg
ggcaaatcccaagaggaagttgtttcgctgttgagaagcaccaagatggaaggaactgtg
agccttctggtctttcgccaggaagacgccttccacccaagggaactgaatgcagagcca
agccagatgcagattccaaaagaaacgaaagcagaagatgaggatattgttcttacacct
gatggcaccagggaatttctgacatttgaagtcccacttaatgattcaggatctgcaggc
cttggtgtcagtgtcaaaggtaaccggtcaaaagagaaccacgcagatttgggaatcttt
gtcaagtccattattaatggaggagcagcatctaaagatggaaggcttcgggtgaatgat
caactgatagcagtaaatggagaatccctgttgggcaagacaaaccaagatgccatggaa
accctaagaaggtctatgtctactgaaggcaataaacgaggaatgatccagcttattgtt
gcaaggagaataagcaagtgcaatgagctgaagtcacctgggagcccccctggacctgag
ctgcccattgaaacagcgttggatgatagagaacgaagaatttcccattccctctacagt
gggattgaggggcttgatgaatcgcccagcagaaatgctgccctcagtaggataatgggt
gagtcaggtaaataccagctgtcccctacagtgaatatgccccaagatgacactgtcatt
atagaagatgacaggttgccagtgcttcctccacatctctctgaccagtcctcttccagc
tcccatgatgatgtggggtttgtgacggcagatgctggtacttgggccaaggctgcaatc
agtgattcagccgactgctctttgagtccagatgttgatccagttcttgcttttcaacga
gaaggatttggacgtcagagtatgtcagaaaaacgcacaaagcaattttcagatgccagt
caattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgag
actaaactcaatacagtggatgaccagaaagcaggttctcccagcagagatgtgggtcct
tccctgggtctgaagaagtcaagctcgttggagagtctgcagaccgcagttgccgaggtg
actttgaatggggatattcctttccatcgtccacggccgcggataatcagaggcagggga
tgcaatgagagcttcagagctgccatcgacaaatcttatgataaacccgcggtagatgat
gatgatgaaggcatggagaccttggaagaagacacagaagaaagttcaagatcagggaga
gagtctgtatccacagccagtgatcagccttcccactctctggagagacaaatgaatgga
aaccaagagaaaggtgataagactgatagaaaaaaggataaaactggaaaagaaaagaag
aaagatagagataaggagaaggataaaatgaaagccaagaagggaatgctgaagggcttg
ggagacatgttcaggtttggcaaacatcgaaaagatgacaagattgagaaaacgggtaaa
ataaaaatacaggaatcctttacatcagaagaggagaggatacgaatgaagcaggagcag
gagaggattcaagccaaaactcgagaatttagggaacgacaagctcgagagcgtgactat
gctgaaattcaagattttcatcggacatttggctgtgatgatgagttaatgtatggggga
gtttcttcttatgaaggttccatggctctcaacgctagacctcagagcccacgagaaggg
catatgatggatgctttgtatgcccaagtcaagaagccgcggaattccaaaccctcacct
gtagacagtaacagatcaactcctagcaatcatgatcggatacagcgtctgaggcaagaa
tttcagcaagcaaagcaagatgaagatgtagaagatcgtcggcggacctatagttttgag
caaccctggccgaacgcacggccggcgacgcagagcgggcgacactcggtgtccgtggag
gtgcagatgcagcggcagcggcaggaggagcgcgagagctcccagcaggcccagcgccag
tacagctctctgcctcggcaaagcaggaaaaatgccagctcggtctcccaggactcttgg
gagcagaactactcccctggggaaggcttccagagtgccaaagagaaccccaggtactcc
agctaccaaggctccaggaacggctacctgggaggacatggcttcaacgccagggtcatg
ctggaaactcaggagctccttcgccaggaacagaggcggaaggagcagcagatgaagaag
cagcctccttccgaggggcccagcaactatgactcgtataagaaagtccaggaccccagt
tacgcccctcccaaggggcccttccggcaagatgtgcccccctccccttctcaggttgcg
aggctgaacagacttcagactcctgagaaagggaggcccttctattcctga

DBGET integrated database retrieval system