KEGG   Homo sapiens (human): 563
Entry
563               CDS       T01001                                 
Symbol
AZGP1, ZA2G, ZAG
Name
(RefSeq) alpha-2-glycoprotein 1, zinc-binding
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 ig MHC_I_2 I-set MHC_II_beta
Other DBs
NCBI-GeneID: 563
NCBI-ProteinID: NP_001176
OMIM: 194460
HGNC: 910
Ensembl: ENSG00000160862
Pharos: P25311(Tbio)
UniProt: P25311 A0A140VK00
Structure
Position
7:complement(99966730..99976031)
AA seq 298 aa
MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFR
YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS
NT seq 897 nt   +upstreamnt  +downstreamnt
atggtaagaatggtgcctgtcctgctgtctctgctgctgcttctgggtcctgctgtcccc
caggagaaccaagatggtcgttactctctgacctatatctacactgggctgtccaagcat
gttgaagacgtccccgcgtttcaggcccttggctcactcaatgacctccagttctttaga
tacaacagtaaagacaggaagtctcagcccatgggactctggagacaggtggaaggaatg
gaggattggaagcaggacagccaacttcagaaggccagggaggacatctttatggagacc
ctgaaagacatcgtggagtattacaacgacagtaacgggtctcacgtattgcagggaagg
tttggttgtgagatcgagaataacagaagcagcggagcattctggaaatattactatgat
ggaaaggactacattgaattcaacaaagaaatcccagcctgggtccccttcgacccagca
gcccagataaccaagcagaagtgggaggcagaaccagtctacgtgcagcgggccaaggct
tacctggaggaggagtgccctgcgactctgcggaaatacctgaaatacagcaaaaatatc
ctggaccggcaagatcctccctctgtggtggtcaccagccaccaggccccaggagaaaag
aagaaactgaagtgcctggcctacgacttctacccagggaaaattgatgtgcactggact
cgggccggcgaggtgcaggagcctgagttacggggagatgttcttcacaatggaaatggc
acttaccagtcctgggtggtggtggcagtgcccccgcaggacacagccccctactcctgc
cacgtgcagcacagcagcctggcccagcccctcgtggtgccctgggaggccagctag

DBGET integrated database retrieval system