KEGG   Homo sapiens (human): 56311
Entry
56311             CDS       T01001                                 

Gene name
ANKRD7, TSA806
Definition
(RefSeq) ankyrin repeat domain 7
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank_3 Ank
Other DBs
NCBI-GeneID: 56311
NCBI-ProteinID: NP_062618
OMIM: 610731
HGNC: 18588
Ensembl: ENSG00000106013
Vega: OTTHUMG00000156960
Pharos: Q92527(Tdark)
UniProt: Q92527 A0A140VJE5
Position
7q31.31
AA seq 254 aa
MNKLFSFWKRKNETRSQGYNLREKDLKKLHRAASVGDLKKLKEYLQIKKYDVNMQDKKYR
TPLHLACANGHTDVVLFLIEQQCKINVRDSENKSPLIKAVQCQNEDCATILLNFGADPDL
RDIRYNTVLHYAVCGQSLSLVEKLLEYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEK
GADVNASDNYQRTALILAVSGEPPCLVKLLLQQGVELCYEGIVDSQLRNMFISMVLLHRY
PQFTASHGKKKHAK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaataagcttttcagcttctggaagaggaagaatgagacccgcagccagggctacaac
cttcgagaaaaggatttaaagaaacttcacagagctgcttcagtcggggatttgaagaag
ctgaaggaataccttcagatcaagaaatatgatgtaaatatgcaggacaaaaaatacaga
acacctttgcacctagcctgtgctaatggacatacagatgttgtacttttcctaattgag
caacaatgcaaaataaatgtccgggatagtgaaaacaaatccccattgattaaggcagta
cagtgtcaaaatgaggattgtgctactattcttctaaactttggtgcagacccagatctg
agggatattcgttataatactgttcttcactatgctgtttgtggtcaaagtttgtcatta
gttgaaaaactgcttgaatacgaagctgatcttgaagcgaaaaataaggatgggtatact
ccactattagttgccgttattaacaataatccaaaaatggtaaaatttcttctggagaaa
ggggctgatgtgaatgcttcagataattatcaaagaacagcccttattcttgctgtcagt
ggtgaaccaccatgtttagtaaagcttcttcttcagcaaggtgtggaattatgttacgaa
ggtattgtggattcacagctgaggaatatgtttatttccatggttttactgcatagatac
ccacaattcactgcgagccatggaaagaagaaacatgctaaatag

DBGET integrated database retrieval system