KEGG   Homo sapiens (human): 56342
Entry
56342             CDS       T01001                                 
Symbol
PPAN, BXDC3, SSF, SSF-1, SSF1, SSF2
Name
(RefSeq) peter pan homolog
  KO
K14859  ribosome biogenesis protein SSF1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    56342 (PPAN)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    56342 (PPAN)
SSDB
Motif
Pfam: Brix
Other DBs
NCBI-GeneID: 56342
NCBI-ProteinID: NP_064615
OMIM: 607793
HGNC: 9227
Ensembl: ENSG00000130810
Vega: OTTHUMG00000156826
UniProt: Q9NQ55
Position
19:10106223..10112012
AA seq 473 aa
MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTAS
RLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRD
VVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRC
LLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSES
EAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSF
VSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSD
EEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRK
RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgggacagtcagggaggtcccggcaccagaagcgcgcccgcgcccaggcgcagctccgc
aacctcgaggcctatgccgcgaacccgcactcgttcgtgttcacgcgaggctgcacgggt
cgcaacatccggcagctcagcctggacgtgcggcgggtcatggagccgctcactgccagc
cgtctgcaggttcgtaagaagaactcgctgaaggactgcgtggcagtggctgggcccctc
ggggtcacacactttctgatcctgagcaaaacagagaccaatgtctactttaagctgatg
cgcctcccaggaggccccaccttgaccttccaggtcaagaagtactcgctggtgcgtgat
gtggtctcctcactgcgccggcaccgcatgcacgagcagcagtttgcccacccacccctc
ctggtactcaacagctttggcccccatggtatgcatgtgaagctcatggccaccatgttc
cagaacctgttcccctccatcaacgtgcacaaggtgaacctgaacaccatcaagcgctgc
ctcctcatcgactacaaccccgactcccaggagctggacttccgccactatagcatcaaa
gttgttcctgtgggcgcgagtcgcgggatgaagaagctgctccaggagaagttccccaac
atgagccgcctgcaggacatcagcgagctgctggccacgggcgcggggctgtcggagagc
gaggcagagcctgacggcgaccacaacatcacagagctgcctcaggctgtcgctggccgt
ggcaacatgcgggcccagcagagtgcagtgcggctcaccgagatcggcccgcggatgaca
ctgcagctcatcaaggtccaggagggcgtcggggagggcaaagtgatgttccacagtttt
gtgagcaagacggaggaggagctgcaggccatcctggaagccaaggagaagaagctgcgg
ctgaaggcgcagaggcaggcccagcaggcccagaatgtgcagcgcaagcaggagcagcgg
gaggcccacagaaagaagagcctggagggcatgaagaaggcacgggtcgggggtagtgat
gaagaggcctctgggatcccttcaaggacggcgagcctggagttgggtgaggacgatgat
gaacaggaagatgatgacatcgagtatttctgccaggcggtgggcgaggcgcccagtgag
gacctgttccccgaggccaagcagaaacggcttgccaagtctccagggcggaagcggaag
cggtgggaaatggatcgaggcaggggtcgcctttgtgaccagaagtttcccaagaccaag
gacaagtcccagggagcccaggccaggcgggggcccagaggggcttcccgggatggtggg
cgaggccggggccggggccgcccagggaagagagtggcctga

DBGET integrated database retrieval system