KEGG   Homo sapiens (human): 5635Help
Entry
5635              CDS       T01001                                 

Gene name
PRPSAP1, PAP39
Definition
(RefSeq) phosphoribosyl pyrophosphate synthetase associated protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyl_synth Pribosyltran_N Pribosyltran
Motif
Other DBs
NCBI-GeneID: 5635
NCBI-ProteinID: NP_002757
OMIM: 601249
HGNC: 9466
Ensembl: ENSG00000161542
Vega: OTTHUMG00000155969
Pharos: Q14558(Tbio)
UniProt: Q14558
Structure
PDB: 

Position
17q25.1
AA seq 385 aa AA seqDB search
MPKKLLLLPPPSASSAFRVPRARPVPPPAMNAARTGYRVFSANSTAACTELAKRITERLG
AELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDVNTAVMELLIMAYALKTACARN
IIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQGFFSFPVDNL
RASPFLLQYIQEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMDD
GRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEI
LKERGAYKIYVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLI
LSEAIRRIHNGESMAYLFRNITVDD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagctgctgctgttgcccccgccctccgcgtcctcggctttccgcgtcccg
cgcgcccgccccgttcccccgccggccatgaacgccgctcgcaccggctaccgagtcttc
tcggccaactccacggccgcctgcacggagctggccaagcgcatcacagagcgccttggt
gctgaattggggaagtctgttgtatatcaagagaccaatggagaaacaagagttgaaata
aaagaatctgttcgtggccaagatattttcattatacagacaatacccagagatgtgaat
acagctgtgatggagttgctcatcatggcttacgcactgaagactgcctgtgccaggaac
attattggggtcatcccctacttcccctacagcaagcagagcaagatgaggaagaggggt
tccattgtgtgcaagctgctagcatccatgctggcgaaagcaggtttaactcacattatc
actatggatcttcatcaaaaggaaatacaaggctttttcagctttcctgtggacaacctt
agagcctcacctttcctgcttcagtatatccaggaagaaattccaaattacagaaatgca
gtcattgtagctaagtctcctgatgctgcaaagagggcccagtcctatgcggagagactg
cgtctgggtttggccgtcattcacggggaagctcagtgcacggaactggacatggacgat
ggtcgtcactccccgcctatggtcaaaaatgctactgtgcacccaggcctggagttgcca
ttgatgatggccaaagagaagccaccgataactgtagttggagatgttggaggccgcatc
gcaatcatcgtggatgacattattgacgatgtggagagttttgttgctgccgcggagatc
ctgaaagagagaggcgcctataagatctatgttatggccacccacggcatcctgtctgca
gaggcccctcgcctgattgaggagtcctccgtagacgaggtggtggtgacgaatactgtc
cctcatgaggttcagaagctgcaatgtcccaagataaagactgtggatatcagtttgatt
ctttctgaagccattcggagaatccacaatggagagtccatggcctaccttttccgaaac
atcactgtggatgactag

DBGET integrated database retrieval system