KEGG   Homo sapiens (human): 5636Help
Entry
5636              CDS       T01001                                 

Gene name
PRPSAP2, PAP41
Definition
(RefSeq) phosphoribosyl pyrophosphate synthetase associated protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyl_synth Pribosyltran_N Pribosyltran UN_NPL4
Motif
Other DBs
NCBI-GeneID: 5636
NCBI-ProteinID: NP_002758
OMIM: 603762
HGNC: 9467
Ensembl: ENSG00000141127
Vega: OTTHUMG00000059406
Pharos: O60256(Tbio)
UniProt: O60256 A0A024QYY3
Structure
PDB: 

Position
17p11.2
AA seq 369 aa AA seqDB search
MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETR
VQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMR
KRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDY
RNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPS
LEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHG
LLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSY
LFRNIGLDD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtgtgacgccacctgaattagaaaccaagatgaacataaccaaaggtggtctg
gtgttgttttcagcaaactcgaattcatcatgtatggagctatcaaagaaaattgcagag
cggctaggggtggagatgggcaaagtgcaggtttaccaggaacctaacagagaaacaaga
gtacaaattcaagagtctgtgaggggaaaagatgttttcatcatccaaactgtttcgaag
gacgtgaacaccaccatcatggagctcctgatcatggtgtatgcatgtaagacctcttgt
gccaagagcatcattggcgtgataccctactttccttacagcaagcagtgcaagatgaga
aaaagaggctccattgtctctaaattgctggcttccatgatgtgcaaagctggtctaact
catcttattactatggatttacaccagaaggaaattcagggcttcttcaatattcctgtt
gacaatttaagagcatctcccttcttattacagtatattcaagaagagatcccagattac
aggaatgcagtaatcgtggccaagtctccagcctcggcgaagagggcacagtcttttgct
gagcgcctgcgcctgggaattgcagtgattcatggagaggcgcaggatgccgagtcggac
ttggtggatggacggcattccccacccatggtcagaagtgtggctgccatccaccccagc
ctggagatccccatgctgattcctaaagaaaagcccccaatcacggttgtgggtgatgtt
ggaggaaggattgccatcatcgtggatgacatcattgatgatgttgacagctttcttgct
gcagcagagaccctgaaggaaagaggtgcatataagatctttgtgatggcaactcatggc
ttgttgtcttctgacgccccccggcggattgaagagtctgccattgatgaggtggtggtc
accaatacaattccacatgaagtccagaagctccagtgccccaagattaaaactgtggat
atcagcatgatcctttcagaggcgatccgtcggatccacaatggggagtccatgtcctac
cttttcagaaacataggcttagatgactga

DBGET integrated database retrieval system