KEGG   Homo sapiens (human): 56475Help
Entry
56475             CDS       T01001                                 

Gene name
RPRM, REPRIMO
Definition
(RefSeq) reprimo, TP53 dependent G2 arrest mediator homolog
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    56475 (RPRM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tmemb_9 BAGE
Motif
Other DBs
NCBI-GeneID: 56475
NCBI-ProteinID: NP_062819
OMIM: 612171
HGNC: 24201
Ensembl: ENSG00000177519
Vega: OTTHUMG00000131905
Pharos: Q9NS64(Tbio)
UniProt: Q9NS64
Position
2q23.3
AA seq 109 aa AA seqDB search
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggccctaggcaaccagacggacgtggcgggcctgttcctggccaacagcagc
gaggcgctggagcgagccgtgcgctgctgcacccaggcgtccgtggtgaccgacgacggc
ttcgcggagggaggcccggacgagcgtagcctgtacataatgcgcgtggtgcagatcgcg
gtcatgtgcgtgctctcactcaccgtggtcttcggcatcttcttcctcggctgcaatctg
ctcatcaagtccgagggcatgatcaacttcctcgtgaaggaccggaggccgtctaaggag
gtggaggcggtggtcgtggggccctactga

DBGET integrated database retrieval system