KEGG   Homo sapiens (human): 56477Help
Entry
56477             CDS       T01001                                 

Gene name
CCL28, CCK1, MEC, SCYA28
Definition
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56477 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    56477 (CCL28)
   04062 Chemokine signaling pathway
    56477 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    56477 (CCL28)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   56477 (CCL28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 56477
NCBI-ProteinID: NP_001288802
OMIM: 605240
HGNC: 17700
Ensembl: ENSG00000151882
Vega: OTTHUMG00000094811
Pharos: Q9NRJ3(Tbio)
UniProt: Q9NRJ3 A0N0Q3
Structure
PDB: 

Position
5p12
AA seq 127 aa AA seqDB search
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagagaggactcgccatcgtggccttggctgtctgtgcggccctacatgcctca
gaagccatacttcccattgcctccagctgttgcacggaggtttcacatcatatttccaga
aggctcctggaaagagtgaatatgtgtcgcatccagagagctgatggggattgtgacttg
gctgctgtcatccttcatgtcaagcgcagaagaatctgtgtcagcccgcacaaccatact
gttaagcagtggatgaaagtgcaagctgccaagaaaaatggtaaaggaaatgtttgccac
aggaagaaacaccatggcaagaggaacagtaacagggcacatcaggggaaacacgaaaca
tacggccataaaactccttattag

DBGET integrated database retrieval system