KEGG   Homo sapiens (human): 56479Help
Entry
56479             CDS       T01001                                 

Gene name
KCNQ5, Kv7.5, MRD46
Definition
(RefSeq) potassium voltage-gated channel subfamily Q member 5
  KO
K04930  potassium voltage-gated channel KQT-like subfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
Disease
H00773  Autosomal dominant mental retardation
Drug target
Flindokalner: D04192
Retigabine: D09569
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    56479 (KCNQ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    56479 (KCNQ5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   56479 (KCNQ5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 56479
NCBI-ProteinID: NP_062816
OMIM: 607357
HGNC: 6299
Ensembl: ENSG00000185760
Vega: OTTHUMG00000015020
Pharos: Q9NR82(Tclin)
UniProt: Q9NR82
Structure
PDB: 

Position
6q13
AA seq 932 aa AA seqDB search
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLK
SSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKET
LRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDL
SMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALALASFQIPPFECEQTSDYQSP
VDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQ
SDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDV
TTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFAS
DSLRTGRSRSSQSICKAGESTDALSLPHVKLK
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccaccacgcgggaggagaggagggcggcgccgccgggctctgggtgaagagc
ggcgcagcggcggcggcggcgggcggggggcgcttgggcagcggcatgaaggatgtggag
tccggccggggcagggtgctgctgaactcggcagccgccaggggcgacggcctgctactg
ctgggcacccgcgcggccacgctcggtggcggcggcggtggcctgagggagagccgccgg
ggcaagcagggggcccggatgagcctgctggggaagccgctctcttacacgagtagccag
agctgccggcgcaacgtcaagtaccggcgggtgcagaactacctgtacaacgtgctggag
agaccccgcggctgggcgttcatctaccacgctttcgtttttctccttgtctttggttgc
ttgattttgtcagtgttttctaccatccctgagcacacaaaattggcctcaagttgcctc
ttgatcctggagttcgtgatgattgtcgtctttggtttggagttcatcattcgaatctgg
tctgcgggttgctgttgtcgatatagaggatggcaaggaagactgaggtttgctcgaaag
cccttctgtgttatagataccattgttcttatcgcttcaatagcagttgtttctgcaaaa
actcagggtaatatttttgccacgtctgcactcagaagtctccgtttcctacagatcctc
cgcatggtgcgcatggaccgaaggggaggcacttggaaattactgggttcagtggtttat
gctcacagcaaggaattaatcacagcttggtacataggatttttggttcttattttttcg
tctttccttgtctatctggtggaaaaggatgccaataaagagttttctacatatgcagat
gctctctggtggggcacaattacattgacaactattggctatggagacaaaactccccta
acttggctgggaagattgctttctgcaggctttgcactccttggcatttctttctttgca
cttcctgccggcattcttggctcaggttttgcattaaaagtacaagaacaacaccgccag
aaacactttgagaaaagaaggaacccagctgccaacctcattcagtgtgtttggcgtagt
tacgcagctgatgagaaatctgtttccattgcaacctggaagccacacttgaaggccttg
cacacctgcagccctaccaagaaagaacaaggggaagcatcaagcagtcagaagctaagt
tttaaggagcgagtgcgcatggctagccccaggggccagagtattaagagccgacaagcc
tcagtaggtgacaggaggtccccaagcaccgacatcacagccgagggcagtcccaccaaa
gtgcagaagagctggagcttcaacgaccgaacccgcttccggccctcgctgcgcctcaaa
agttctcagccaaaaccagtgatagatgctgacacagcccttggcactgatgatgtatat
gatgaaaaaggatgccagtgtgatgtatcagtggaagacctcaccccaccacttaaaact
gtcattcgagctatcagaattatgaaatttcatgttgcaaaacggaagtttaaggaaaca
ttacgtccatatgatgtaaaagatgtcattgaacaatattctgctggtcatctggacatg
ttgtgtagaattaaaagccttcaaacacgtgttgatcaaattcttggaaaagggcaaatc
acatcagataagaagagccgagagaaaataacagcagaacatgagaccacagacgatctc
agtatgctcggtcgggtggtcaaggttgaaaaacaggtacagtccatagaatccaagctg
gactgcctactagacatctatcaacaggtccttcggaaaggctctgcctcagccctcgct
ttggcttcattccagatcccaccttttgaatgtgaacagacatctgactatcaaagccct
gtggatagcaaagatctttcgggttccgcacaaaacagtggctgcttatccagatcaact
agtgccaacatctcgagaggcctgcagttcattctgacgccaaatgagttcagtgcccag
actttctacgcgcttagccctactatgcacagtcaagcaacacaggtgccaattagtcaa
agcgatggctcagcagtggcagccaccaacaccattgcaaaccaaataaatacggcaccc
aagccagcagccccaacaactttacagatcccacctcctctcccagccatcaagcatctg
cccaggccagaaactctgcaccctaaccctgcaggcttacaggaaagcatttctgacgtc
accacctgccttgttgcctccaaggaaaatgttcaggttgcacagtcaaatctcaccaag
gaccgttctatgaggaaaagctttgacatgggaggagaaactctgttgtctgtctgtccc
atggtgccgaaggacttgggcaaatctttgtctgtgcaaaacctgatcaggtcgaccgag
gaactgaatatacaactttcagggagtgagtcaagtggctccagaggcagccaagatttt
taccccaaatggagggaatccaaattgtttataactgatgaagaggtgggtcccgaagag
acagagacagacacttttgatgccgcaccgcagcctgccagggaagctgcctttgcatca
gactctctaaggactggaaggtcacgatcatctcagagcatttgtaaggcaggagaaagt
acagatgccctcagcttgcctcatgtcaaactgaaataa

DBGET integrated database retrieval system