KEGG   Homo sapiens (human): 56547Help
Entry
56547             CDS       T01001                                 

Gene name
MMP26
Definition
(RefSeq) matrix metallopeptidase 26
  KO
K08004  matrix metalloproteinase-26 (matrilysin-2, endometase) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    56547 (MMP26)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     56547 (MMP26)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   56547 (MMP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Reprolysin_3 Reprolysin_5 Reprolysin_4 DUF4953 Peptidase_M57 Astacin Peptidase_M43 Metallopep Peptidase_M66 Peptidase_M54
Motif
Other DBs
NCBI-GeneID: 56547
NCBI-ProteinID: NP_068573
OMIM: 605470
HGNC: 14249
Ensembl: ENSG00000167346
Vega: OTTHUMG00000066442
Pharos: Q9NRE1(Tchem)
UniProt: Q9NRE1
Position
11p15.4
AA seq 261 aa AA seqDB search
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcgtcatcttaagagttactatcttcttgccctggtgtttcgccgttccagtg
ccccctgctgcagaccataaaggatgggactttgttgagggctatttccatcaatttttc
ctgaccaagaaggagtcgccactccttacccaggagacacaaacacagctcctgcaacaa
ttccatcggaatgggacagacctacttgacatgcagatgcatgctctgctacaccagccc
cactgtggggtgcctgatgggtccgacacctccatctcgccaggaagatgcaagtggaat
aagcacactctaacttacaggattatcaattacccacatgatatgaagccatccgcagtg
aaagacagtatatataatgcagtttccatctggagcaatgtgacccctttgatattccag
caagtgcagaatggagatgcagacatcaaggtttctttctggcagtgggcccatgaagat
ggttggccctttgatgggccaggtggtatcttaggccatgcctttttaccaaattctgga
aatcctggagttgtccattttgacaagaatgaacactggtcagcttcagacactggatat
aatctgttcctggttgcaactcatgagattgggcattctttgggcctgcagcactctggg
aatcagagctccataatgtaccccacttactggtatcacgaccctagaaccttccagctc
agtgccgatgatatccaaaggatccagcatttgtatggagaaaaatgttcatctgacata
ccttaa

DBGET integrated database retrieval system