KEGG   Homo sapiens (human): 5657
Entry
5657              CDS       T01001                                 

Gene name
PRTN3, ACPA, AGP7, C-ANCA, CANCA, MBN, MBT, NP-4, NP4, P29, PR-3, PR3
Definition
(RefSeq) proteinase 3
  KO
K01350  myeloblastin [EC:3.4.21.76]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5657 (PRTN3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.76  myeloblastin
     5657 (PRTN3)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5657 (PRTN3)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2 DUF3153
Other DBs
NCBI-GeneID: 5657
NCBI-ProteinID: NP_002768
OMIM: 177020
HGNC: 9495
Ensembl: ENSG00000196415
Vega: OTTHUMG00000181838
Pharos: P24158(Tchem)
UniProt: P24158
Structure
PDB: 
1FUJ

Position
19p13.3
AA seq 256 aa
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL
IHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL
LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF
FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYV
DWIRSTLRRVEAKGRP
NT seq 771 nt   +upstreamnt  +downstreamnt
atggctcaccggccccccagccctgccctggcgtccgtgctgctggccttgctgctgagc
ggtgctgcccgagctgcggagatcgtgggcgggcacgaggcgcagccacactcccggccc
tacatggcctccctgcagatgcgggggaacccgggcagccacttctgcggaggcaccttg
atccaccccagcttcgtgctgacggccgcgcactgcctgcgggacataccccagcgcctg
gtgaacgtggtgctcggagcccacaacgtgcggacgcaggagcccacccagcagcacttc
tcggtggctcaggtgtttctgaacaactacgacgcggagaacaaactgaacgacgttctc
ctcatccagctgagcagcccagccaacctcagtgcctccgtcgccacagtccagctgcca
cagcaggaccagccagtgccccacggcacccagtgcctggccatgggctggggccgcgtg
ggtgcccacgaccccccagcccaggtcctgcaggagctcaatgtcaccgtggtcaccttc
ttctgccggccacataacatttgcactttcgtccctcgccgcaaggccggcatctgcttc
ggagactcaggtggccccctgatctgtgatggcatcatccaaggaatagactccttcgtg
atctggggatgtgccacccgccttttccctgacttcttcacgcgggtagccctctacgtg
gactggatccgttccacgctgcgccgtgtggaggccaagggccgcccctga

DBGET integrated database retrieval system