KEGG   Homo sapiens (human): 56606Help
Entry
56606             CDS       T01001                                 

Gene name
SLC2A9, GLUT9, GLUTX, UAQTL2, URATv1
Definition
(RefSeq) solute carrier family 2 member 9
  KO
K08146  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 9
Organism
hsa  Homo sapiens (human)
Disease
H00948  Renal hypouricemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    56606 (SLC2A9)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   56606 (SLC2A9)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    56606 (SLC2A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 56606
NCBI-ProteinID: NP_064425
OMIM: 606142
HGNC: 13446
Ensembl: ENSG00000109667
Vega: OTTHUMG00000044263
Pharos: Q9NRM0(Tbio)
UniProt: Q9NRM0
Position
4p16.1
AA seq 540 aa AA seqDB search
MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVAS
LAGAFGSSFLYGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIG
GLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGV
ALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGLPELLGKESTWPYLFGVIVV
PAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIR
LVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLST
GGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGIL
AIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYC
FLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaacaaaataggaattccaaggaactgggcctagttcccctcacagatgac
accagccacgccgggcctccagggccagggagggcactgctggagtgtgaccacctgagg
agtggggtgccaggtggaaggagaagaaaggactggtcctgctcgctcctcgtggcctcc
ctcgcgggcgccttcggctcctccttcctctacggctacaacctgtcggtggtgaatgcc
cccaccccgtacatcaaggccttttacaatgagtcatgggaaagaaggcatggacgtcca
atagacccagacactctgactttgctctggtctgtgactgtgtccatattcgccatcggt
ggacttgtggggacgttaattgtgaagatgattggaaaggttcttgggaggaagcacact
ttgctggccaataatgggtttgcaatttctgctgcattgctgatggcctgctcgctccag
gcaggagcctttgaaatgctcatcgtgggacgcttcatcatgggcatagatggaggcgtc
gccctcagtgtgctccccatgtaccttagtgagatctcacccaaggagatccgtggctct
ctggggcaggtgactgccatctttatctgcattggcgtgttcactgggcagcttctgggc
ctgcccgagctgctgggaaaggagagtacctggccatacctgtttggagtgattgtggtc
cctgccgttgtccagctgctgagccttccctttctcccggacagcccacgctacctgctc
ttggagaagcacaacgaggcaagagctgtgaaagccttccaaacgttcttgggtaaagca
gacgtttcccaagaggtagaggaggtcctggctgagagccgcgtgcagaggagcatccgc
ctggtgtccgtgctggagctgctgagagctccctacgtccgctggcaggtggtcaccgtg
attgtcaccatggcctgctaccagctctgtggcctcaatgcaatttggttctataccaac
agcatctttggaaaagctgggatccctccggcaaagatcccatacgtcaccttgagtaca
gggggcatcgagactttggctgccgtcttctctggtttggtcattgagcacctgggacgg
agacccctcctcattggtggctttgggctcatgggcctcttctttgggaccctcaccatc
acgctgaccctgcaggaccacgccccctgggtcccctacctgagtatcgtgggcattctg
gccatcatcgcctctttctgcagtgggccaggtggcatcccgttcatcttgactggtgag
ttcttccagcaatctcagcggccggctgccttcatcattgcaggcaccgtcaactggctc
tccaactttgctgttgggctcctcttcccattcattcagaaaagtctggacacctactgt
ttcctagtctttgctacaatttgtatcacaggtgctatctacctgtattttgtgctgcct
gagaccaaaaacagaacctatgcagaaatcagccaggcattttccaaaaggaacaaagca
tacccaccagaagagaaaatcgactcagctgtcactgatggtaagataaatggaaggcct
taa

DBGET integrated database retrieval system