KEGG   Homo sapiens (human): 5662
Entry
5662              CDS       T01001                                 
Symbol
PSD, EFA6, EFA6A, PSD1, TYL
Name
(RefSeq) pleckstrin and Sec7 domain containing
  KO
K12494  PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5662 (PSD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5662 (PSD)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    5662 (PSD)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 5662
NCBI-ProteinID: NP_001257894
OMIM: 602327
HGNC: 9507
Ensembl: ENSG00000059915
UniProt: A5PKW4
Position
10:complement(102402619..102419946)
AA seq 1024 aa
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVSPPRPTPALGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGPPAP
PQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKW
EFFYGSLDPPSSGAKPPEQAPPSPPGVGSRQGSGVAVGRAAKYSETDLDTVPLRCYRETD
IDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPLPGPHPSLGSGNEDEDDDEAGGE
EDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY
TSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQ
RGEEEEAEARAKLAPGREPPSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLA
LGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVF
TGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLL
NTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRS
LSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGK
RGWKSFHGILKGMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLR
TADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQ
EEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLR
VKLKAGSEELDAVEAALAQAGSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSG
RRKP
NT seq 3075 nt   +upstreamnt  +downstreamnt
atggcccagggtgccatgcgcttctgctcggaaggcgactgtgccatctccccaccacga
tgcccacgccgctggctccccgaaggcccggtgccccagagccccccagccagcatgtat
ggcagcacaggctccttgctacggcgagtggcaggtccaggtcctcgaggccgggaactg
ggacgtgtgacagcaccctgtacacctctgcgtggccccccctcaccccgtgttgctccc
tcaccctgggcaccctcttcacccactgggcagcccccacccggggcccagagctctgtg
gtcatcttccgctttgtggagaaggccagtgtgaggccactgaatgggctacctgctcca
gggggcttgagtcggagctgggatctgggtggggtttctcctcccaggcccaccccagcc
cttgggcctggctccaaccggaagttacggctggaagcatccacatcagacccactcccc
gccagaggaggctcggccctacctggcagccggaaccttgtacatgggccgccagcccca
ccccaggttggagcagatggcctttactcctctctccccaatgggctggggggcccccct
gagcgcctggccacactcttcggaggacctgctgacactggattcctgaaccagggggat
acctggtcctccccccgggaagtctcctctcatgcccagagaatcgctagagccaaatgg
gaattcttctatggctccttggacccccccagctcaggtgctaagcccccagagcaggcc
cccccatctccacctggggtgggctcaaggcagggctctggggtggctgtggggcgagca
gccaagtactccgagacagacctggacacggtgcccctgaggtgctaccgcgagactgac
atcgatgaggtgctggctgagcgggaggaggccgactcggccatcgaaagtcagcccagc
tctgagggcccaccaggcactgcctacccacctgccccacggcccggcccactccctggc
cctcatcccagcctcggcagtggcaatgaggatgaggacgacgatgaggcaggtggggaa
gaagatgtggacgacgaggtgtttgaggcctctgaaggggcccggccagggagccggatg
cctctcaagtcacctgtgccctttctacctgggacgagcccctcggctgatgggcctgac
tctttcagttgtgtgttcgaagccatcctggagtcacaccgggccaaaggcacctcctat
accagcctcgcctcgctggaggccttggcctcacctggcccaacccagagccccttcttc
acctttgagctgcctccccaaccccctgcaccccggcccgacccaccagctcccgcccca
cttgcccctcttgaaccggattctggtaccagctctgctgctgatggtccttggacacag
agaggggaggaggaggaggcagaggccagagccaagctggccccagggagggagccccct
agtccctgccactcagaggacagccttgggctgggggcagcaccccttggcagcgaacca
cccctgagccagctggtgtccgactcagactcagagctggacagcacagagcggctggcc
ctgggaagcacagacaccttgtccaatgggcagaaagcggacctggaggctgcgcagcgc
ctggccaagaggctgtaccgactagatggcttcaggaaggccgatgtggcccggcacctg
ggcaagaacaatgacttcagcaaactggtggctggggagtacctcaagttctttgtcttc
acgggcatgactctggaccaagctctcagggtgtttctgaaggagctggccttaatgggt
gagacccaggaacgagagcgcgtgctggcccacttctcccagcgatacttccagtgcaat
cctgaagccctgtcctcagaggacggcgcccacacgctgacctgtgcgctcatgctgctc
aacacggatctccacggccataacatcgggaagcgcatgacctgcggggacttcatcggg
aacctggagggcctcaatgatggcggcgacttccctagggagctgctcaaggccttgtac
agctccatcaagaatgagaagctgcagtgggccatagacgaggaggagctgagacgctct
ctgtctgagttggccgaccccaaccccaaggtcatcaagcggatcagcgggggcagtggc
agtggctccagccctttcctggacctgactcccgagcctggggctgccgtctacaagcac
ggggccctggtgcgaaaggtgcacgcagaccctgactgcaggaagacacctcggggcaag
cggggctggaagagcttccacgggatcctcaagggcatgatcctctacctgcagaaggag
gagtacaagcctgggaaggccctttcagagacggagctcaagaatgccatcagcatccac
catgccctggccactcgtgccagtgactacagcaagaggccccacgtcttctacctgcgc
acagctgactggcgggtcttcctcttccaggccccgagcctggagcagatgcagtcctgg
atcactcgcatcaatgtagtagccgctatgttctctgcgccccccttcccagctgctgtt
agctcccaaaagaagttcagccgccctctcctgcccagcgctgccacccgcctctcccag
gaggagcaggtgcggacccacgaggccaagctgaaggccatggcaagtgagctgcgggag
caccgggccgcccagctgggcaagaagggccggggcaaggaggctgaagagcagcggcag
aaggaggcctacctggagtttgagaaatcccgctacagcacctatgcagcgctgcttcgg
gtcaagctgaaggcaggcagtgaggagctggatgcagtggaggcagcactggcccaggcc
gggagcacagaggatggactccctccttctcactccagtccctccctgcagcccaaaccc
tccagccagccccgggctcagcgtcacagctcagagcctcggccaggggcaggcagtggg
cggcggaagccctga

DBGET integrated database retrieval system