KEGG   Homo sapiens (human): 56624Help
Entry
56624             CDS       T01001                                 

Gene name
ASAH2, BCDase, HNAC1, LCDase, N-CDase, NCDase
Definition
(RefSeq) N-acylsphingosine amidohydrolase 2
  KO
K12349  neutral ceramidase [EC:3.5.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00099  Sphingosine biosynthesis
Network
nt06014  Sphingolipid degradation
  Element
N00649  Hydrolysis of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    56624 (ASAH2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    56624 (ASAH2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     56624 (ASAH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ceramidase_alk Ceramidse_alk_C Pga1
Motif
Other DBs
NCBI-GeneID: 56624
NCBI-ProteinID: NP_063946
OMIM: 611202
HGNC: 18860
Ensembl: ENSG00000188611
Vega: OTTHUMG00000018223
Pharos: Q9NR71(Tbio)
UniProt: Q9NR71
Structure
PDB: 

Position
10q11.23
AA seq 780 aa AA seqDB search
MAKRTFSNLETFLIFLLVMMSAITVALLSLLFITSGTIENHKDLGGHFFSTTQSPPATQG
STAAQRSTATQHSTATQSSTATQTSPVPLTPESPLFQNFSGYHIGVGRADCTGQVADINL
MGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYG
SLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKP
GKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWF
AIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQGPFVAAFASSNLGDVSPNILGP
RCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQEVT
GPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFW
DTIRDQILGKPSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGE
FTTMSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTHYITTYEEYQAQRYEAASTIYGP
HTLSAYIQLFRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQ
PAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFY
WHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcaccttctctaacttggagacattcctgattttcctccttgtaatgatg
agtgccatcacagtggcccttctcagcctcttgtttatcaccagtgggaccattgaaaac
cacaaagatttaggaggccattttttttcaaccacccaaagccctccagccacccagggc
tccacagctgcccaacgctccacagccacccagcattccacagccacccagagctccaca
gccactcaaacttctccagtgcctttaaccccagagtctcctctatttcagaacttcagt
ggctaccatattggtgttggacgagctgactgcacaggacaagtagcagatatcaatttg
atgggctatggcaaatccggccagaatgcacagggcatcctcaccaggctatacagtcgt
gccttcatcatggcagaacctgatgggtccaatcgaacagtgtttgtcagcatcgacata
ggcatggtatcacaaaggctcaggctggaggtcctgaacagactgcagagtaaatatggc
tccctgtacagaagagataatgtcatcctgagtggcactcacactcattcaggtcctgca
ggatatttccagtataccgtgtttgtaattgccagtgaaggatttagcaatcaaactttt
cagcacatggtcactggtatcttgaagagcattgacatagcacacacaaatatgaaacca
ggcaaaatcttcatcaataaaggaaatgtggatggtgtgcagatcaacagaagtccgtat
tcttaccttcaaaatccgcagtcagagagagcaaggtattcttcaaatacagacaaggaa
atgatagttttgaaaatggtagatttgaatggagatgacttgggccttatcagctggttt
gccatccacccggtcagcatgaacaacagtaaccatcttgtaaacagtgacaatgtgggc
tatgcatcttacctgcttgagcaagagaagaacaaaggatatctacctggacaggggcca
tttgtagcagcctttgcttcatcaaacctaggagatgtgtcccccaacattcttggacca
cgttgcatcaacacaggagagtcctgtgataacgccaatagcacttgtcccattggtggg
cctagcatgtgcattgctaagggacctggacaggatatgtttgacagcacacaaattata
ggacgggccatgtatcagagagcaaaggaactctatgcctctgcctcccaggaggtaaca
ggaccactggcttcagcacaccagtgggtggatatgacagatgtgactgtctggctcaat
tccacacatgcatcaaaaacatgtaaaccagcattgggctacagttttgcagctggcact
attgatggagttggaggcctcaattttacacaggggaaaacagaaggggatccattttgg
gacaccattcgggaccagatcctgggaaagccatctgaagaaattaaagaatgtcataaa
ccaaagcccatccttcttcacaccggagaactatcaaaacctcacccctggcatccagac
attgttgatgttcagattattacccttgggtccttggccataactgccatccccggggag
tttacgaccatgtctggacgaagacttcgagaggcagttcaagcagaatttgcatctcat
gggatgcagaacatgactgttgttatttcaggtctatgcaacgtctatacacattacatt
accacttatgaagaataccaggctcagcgatatgaggcagcatcgacaatttatggaccg
cacacattatctgcttacattcagctcttcagaaaccttgctaaggctattgctacggac
acggtagccaacctgagcagaggtccagaacctccctttttcaaacaattaatagttcca
ttaattcctagtattgtggatagagcaccaaaaggcagaactttcggggatgtcctgcag
ccagcaaaacctgaatacagagtgggggaagttgctgaagttatatttgtaggtgctaac
ccgaagaattcagtacaaaaccagacccatcagaccttcctcactgtggagaaatatgag
gctacttcaacatcgtggcagatagtgtgtaatgatgcctcctgggagactcgtttttat
tggcacaagggactcctgggtctgagtaatgcaacagtggaatggcatattccagacact
gcccagcctggaatctacagaataagatattttggacacaatcggaagcaggacattctg
aagcctgctgtcatactttcatttgaaggcacttccccggcttttgaagttgtaactatt
tag

DBGET integrated database retrieval system