KEGG   Homo sapiens (human): 5664Help
Entry
5664              CDS       T01001                                 

Gene name
PSEN2, AD3L, AD4, CMD1V, PS2, STM2
Definition
(RefSeq) presenilin 2
  KO
K04522  presenilin 2 [EC:3.4.23.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05010  Alzheimer disease
Module
hsa_M00682  Notch signaling
Disease
H00056  Alzheimer disease
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    5664 (PSEN2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5664 (PSEN2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    5664 (PSEN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5664 (PSEN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     5664 (PSEN2)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A22: presenilin family
   5664 (PSEN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Presenilin
Motif
Other DBs
NCBI-GeneID: 5664
NCBI-ProteinID: NP_000438
OMIM: 600759
HGNC: 9509
Ensembl: ENSG00000143801
Vega: OTTHUMG00000037563
Pharos: P49810(Tchem)
UniProt: P49810
Position
1q42.13
AA seq 448 aa AA seqDB search
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDP
DRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLI
YTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLL
FLFTYIYLGEVLKTYNVAMDYPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMA
LVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGV
KLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISI
TFGLIFYFSTDNLVRPFMDTLASHQLYI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctcacattcatggcctctgacagcgaggaagaagtgtgtgatgagcggacgtcccta
atgtcggctgagagccccacgccgcgctcctgccaggagggcaggcagggcccagaggat
ggagagaacactgcccagtggagaagccaggagaacgaggaggacggtgaggaggaccct
gaccgctatgtctgtagtggggttcccgggcggccgccaggcctggaggaagagctgacc
ctcaaatacggagcgaagcacgtgatcatgctgtttgtgcctgtcactctgtgcatgatc
gtggtggtagccaccatcaagtctgtgcgcttctacacagagaagaatggacagctcatc
tacacgccattcactgaggacacaccctcggtgggccagcgcctcctcaactccgtgctg
aacaccctcatcatgatcagcgtcatcgtggttatgaccatcttcttggtggtgctctac
aagtaccgctgctacaagttcatccatggctggttgatcatgtcttcactgatgctgctg
ttcctcttcacctatatctaccttggggaagtgctcaagacctacaatgtggccatggac
taccccaccctcttgctgactgtctggaacttcggggcagtgggcatggtgtgcatccac
tggaagggccctctggtgctgcagcaggcctacctcatcatgatcagtgcgctcatggcc
ctagtgttcatcaagtacctcccagagtggtccgcgtgggtcatcctgggcgccatctct
gtgtatgatctcgtggctgtgctgtgtcccaaagggcctctgagaatgctggtagaaact
gcccaggagagaaatgagcccatattccctgccctgatatactcatctgccatggtgtgg
acggttggcatggcgaagctggacccctcctctcagggtgccctccagctcccctacgac
ccggagatggaagaagactcctatgacagttttggggagccttcataccccgaagtcttt
gagcctcccttgactggctacccaggggaggagctggaggaagaggaggaaaggggcgtg
aagcttggcctcggggacttcatcttctacagtgtgctggtgggcaaggcggctgccacg
ggcagcggggactggaataccacgctggcctgcttcgtggccatcctcattggcttgtgt
ctgaccctcctgctgcttgctgtgttcaagaaggcgctgcccgccctccccatctccatc
acgttcgggctcatcttttacttctccacggacaacctggtgcggccgttcatggacacc
ctggcctcccatcagctctacatctga

DBGET integrated database retrieval system