KEGG   Homo sapiens (human): 56650
Entry
56650             CDS       T01001                                 
Symbol
CLDND1, C3orf4, GENX-3745, Z38
Name
(RefSeq) claudin domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin SUR7
Other DBs
NCBI-GeneID: 56650
NCBI-ProteinID: NP_001035271
OMIM: 619677
HGNC: 1322
Ensembl: ENSG00000080822
Pharos: Q9NY35(Tdark)
UniProt: Q9NY35
Position
3:complement(98515483..98522902)
AA seq 253 aa
MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD
EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV
DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA
GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN
RKEYTLMKAYRVA
NT seq 762 nt   +upstreamnt  +downstreamnt
atggataaccgttttgctacagcatttgtaattgcttgtgtgcttagcctcatttccacc
atctacatggcagcctccattggcacagacttctggtatgaatatcgaagtccagttcaa
gaaaattccagtgatttgaataaaagcatctgggatgaattcattagtgatgaggcagat
gaaaagacttataatgatgcactttttcgatacaatggcacagtgggattgtggagacgg
tgtatcaccatacccaaaaacatgcattggtatagcccaccagaaaggacagagtcattt
gatgtggtcacaaaatgtgtgagtttcacactaactgagcagttcatggagaaatttgtt
gatcccggaaaccacaatagcgggattgatctccttaggacctatctttggcgttgccag
ttccttttaccttttgtgagtttaggtttgatgtgctttggggctttgatcggactttgt
gcttgcatttgccgaagcttatatcccaccattgccacgggcattctccatctccttgca
ggtctgtgtacactgggctcagtaagttgttatgttgctggaattgaactactccaccag
aaactagagctccctgacaatgtatccggtgaatttggatggtccttctgcctggcttgt
gtctctgctcccttacagttcatggcttctgctctcttcatctgggctgctcacaccaac
cggaaagagtacaccttaatgaaggcatatcgtgtggcatga

DBGET integrated database retrieval system