KEGG   Homo sapiens (human): 56654Help
Entry
56654             CDS       T01001                                 

Gene name
NPDC1, CAB, CAB-, CAB-1, CAB1, NPDC-1
Definition
(RefSeq) neural proliferation, differentiation and control 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: NPDC1
Motif
Other DBs
NCBI-GeneID: 56654
NCBI-ProteinID: NP_056207
OMIM: 605798
HGNC: 7899
Ensembl: ENSG00000107281
Vega: OTTHUMG00000020956
Pharos: Q9NQX5(Tbio)
UniProt: Q9NQX5
Position
9q34.3
AA seq 325 aa AA seqDB search
MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGA
HACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPK
DRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQG
DGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQ
RLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEME
VRNPLFDHAALSAPLPAPSSPPALP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgccgctgcctccgccctccccgcggcacctgcggctgctgcggctgctgctc
tccggcctcgtcctcggcgccgccctgcgtggagccgccgccggccacccggatgtagcc
gcctgtcccgggagcctggactgtgccctgaagaggcgggcaaggtgtcctcctggtgca
catgcctgtgggccctgccttcagcccttccaggaggaccagcaagggctctgtgtgccc
aggatgcgccggcctccaggcgggggccggccccagcccagactggaagatgagattgac
ttcctggcccaggagcttgcccggaaggagtctggacactcaactccgcccctacccaag
gaccgacagcggctcccggagcctgccaccctgggcttctcggcacgggggcaggggctg
gagctgggcctcccctccactccaggaacccccacgcccacgccccacacctccctgggc
tcccctgtgtcatccgacccggtgcacatgtcgcccctggagccccggggagggcaaggc
gacggcctcgcccttgtgctgatcctggcgttctgtgtggccggtgcagccgccctctcc
gtagcctccctctgctggtgcaggctgcagcgtgagatccgcctgactcagaaggccgac
tacgccactgcgaaggcccctggctcacctgcagctccccggatctcgcctggggaccag
cggctggcacagagcgcggagatgtaccactaccagcaccaacggcaacagatgctgtgc
ctggagcggcataaagagccacccaaggagctggacacggcctcctcggatgaggagaat
gaggacggagacttcacggtgtacgagtgcccgggcctggccccgaccggggaaatggag
gtgcgcaaccctctgttcgaccacgccgcactgtccgcgcccctgccggcccccagctca
ccgcctgcactgccatga

DBGET integrated database retrieval system