KEGG   Homo sapiens (human): 56655
Entry
56655             CDS       T01001                                 

Symbol
POLE4, YHHQ1, p12
Name
(RefSeq) DNA polymerase epsilon 4, accessory subunit
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    56655 (POLE4)
   03410 Base excision repair
    56655 (POLE4)
   03420 Nucleotide excision repair
    56655 (POLE4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    56655 (POLE4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    56655 (POLE4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     56655 (POLE4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    56655 (POLE4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      56655 (POLE4)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TAF CENP-T_C
Other DBs
NCBI-GeneID: 56655
NCBI-ProteinID: NP_063949
OMIM: 607269
HGNC: 18755
Ensembl: ENSG00000115350
Vega: OTTHUMG00000129971
Pharos: Q9NR33(Tdark)
UniProt: Q9NR33
Position
2p12
AA seq 117 aa
MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAG
QEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
NT seq 354 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcaggaagcgggacgccccgagaggaggagggacctgctggg
gaggcagcggcctcgcagccccaggccccaacgagtgtgcctggggctcgtctctcgagg
ttgcctctggcgcgagtgaaggccttggtgaaggcagatcccgacgtgacgctagcggga
caggaagccatcttcattctggcacgagccgcggaactgtttgtggagaccattgcaaaa
gatgcctactgttgcgctcagcagggaaaaaggaaaacccttcagaggagagacttggat
aatgcaatagaagctgtggatgaatttgcttttctggaaggtactttagattga

DBGET integrated database retrieval system