KEGG   Homo sapiens (human): 56681
Entry
56681             CDS       T01001                                 

Gene name
SAR1A, SAR1, SARA1, Sara, masra2
Definition
(RefSeq) secretion associated Ras related GTPase 1A
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05134  Legionellosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56681 (SAR1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    56681 (SAR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56681 (SAR1A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    56681 (SAR1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     56681 (SAR1A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    56681 (SAR1A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    56681 (SAR1A)
SSDB
Motif
Pfam: Arf SRPRB G-alpha Roc Ras MMR_HSR1 GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 56681
NCBI-ProteinID: NP_001136120
OMIM: 607691
HGNC: 10534
Ensembl: ENSG00000079332
Vega: OTTHUMG00000018400
Pharos: Q9NR31(Tbio)
UniProt: Q9NR31 Q5SQT9
Structure
PDB: 
2GAO

Position
10q22.1
AA seq 198 aa
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMT
DETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSV
LKRQGYGEGFRWLSQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtctttcatctttgagtggatctacaatggcttcagcagtgtgctccagttcctagga
ctgtacaagaaatctggaaaacttgtattcttaggtttggataatgcaggcaaaaccact
cttcttcacatgctcaaagatgacagattgggccaacatgttccaacactacatccgaca
tcagaagagctaacaattgctggaatgacctttacaacttttgatcttggtgggcacgag
caagcacgtcgcgtttggaaaaattatctcccagcaattaatgggattgtctttctggtg
gactgtgcagatcattctcgcctcgtggaatccaaagttgagcttaatgctttaatgact
gatgaaacaatatccaatgtgccaatccttatcttgggtaacaaaattgacagaacagat
gcaatcagtgaagaaaaactccgtgagatatttgggctttatggacagaccacaggaaag
gggaatgtgaccctgaaggagctgaatgctcgccccatggaagtgttcatgtgcagtgtg
ctcaagaggcaaggttacggcgagggtttccgctggctctcccagtatattgactga

DBGET integrated database retrieval system