KEGG   Homo sapiens (human): 5676
Entry
5676              CDS       T01001                                 

Gene name
PSG7, PSBG-7, PSG1, PSGGA
Definition
(RefSeq) pregnancy specific beta-1-glycoprotein 7
  KO
K06500  pregnancy specific beta-1-glycoprotein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    5676 (PSG7)
CD molecules [BR:hsa04090]
 Proteins
  5676 (PSG7)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Ig_4 Ig_5 Ig_6
Other DBs
NCBI-GeneID: 5676
NCBI-ProteinID: NP_002774
OMIM: 176396
HGNC: 9524
Ensembl: ENSG00000221878
Vega: OTTHUMG00000151125
Pharos: Q13046(Tbio)
UniProt: Q13046
Position
19q13.31
AA seq 419 aa
MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQ
NLTGYIWYKGQIRDLYHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSY
TLHIIKRGDGTGGVTGRFTFTLYLETPKPSISSSNFNPREATEAVILTCDPETPDASYLW
WMNGQSLPMTHSLQLSETNRTLYLFGVTNYTAGPYECEIRNPVSASRSDPVTLNLLPKLP
KPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSLPVSPRVKRRIENRILILPSV
TRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNLYLSCFADSNP
PAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggggcccctctcagcccctccctgcacacagcatataacctggaaagggctcctgctc
acagcatcacttttaaacttctggaacccgcccaccacagcccaagtcacgattgaagcc
cagccaccaaaagtttccgaggggaaggatgttcttctacttgtccacaatttgccccag
aatcttactggctacatctggtacaaaggacaaatcagggacctctaccattatgttaca
tcatatatagtagacggtcaaataattaaatatgggcctgcatacagtggacgagaaaca
gtatattccaatgcatccctgctgatccagaatgtcacccaggaagacacaggatcctac
actttacacatcataaagcgaggtgatgggactggaggagtaactggacgtttcaccttc
accttatacctggagactcccaaaccctccatctccagcagcaatttcaaccccagggag
gccacggaggctgtgattttaacctgtgatcctgagactccagatgcaagctacctgtgg
tggatgaatggtcagagcctccctatgactcacagcttgcagctgtctgaaaccaacagg
accctctacctatttggtgtcacaaactatactgcaggaccctatgaatgtgaaatacgg
aacccagtgagtgccagccgcagtgacccagtcaccctgaatctcctcccgaagctgccc
aagccctacatcaccatcaataacttaaaccccagggagaataaggatgtctcaaccttc
acctgtgaacctaagagtgagaactacacctacatttggtggctaaatggtcagagcctc
ccggtcagtcccagggtaaagcgacgcattgaaaacaggatcctcattctacccagtgtc
acgagaaatgaaacaggaccctatcaatgtgaaatacgggaccgatatggtggcatccgc
agtgacccagtcaccctgaatgtcctctatggtccagacctccccagaatttacccttca
ttcacctattaccattcaggacaaaacctctacttgtcctgctttgcggactctaaccca
ccggcacagtattcttggacaattaatgggaagtttcagctatcaggacaaaagctttct
atcccccagattactacaaagcatagcgggctctatgcttgctctgttcgtaactcagcc
actggcaaggaaagctccaaatccgtgacagtcagagtctctgactggacattaccctga

DBGET integrated database retrieval system