KEGG   Homo sapiens (human): 5682Help
Entry
5682              CDS       T01001                                 

Gene name
PSMA1, HC2, HEL-S-275, NU, PROS30
Definition
(RefSeq) proteasome subunit alpha 1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Module
hsa_M00337  Immunoproteasome
hsa_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5682 (PSMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5682 (PSMA1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5682 (PSMA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5682 (PSMA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5682 (PSMA1)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T1: proteasome family
   5682 (PSMA1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5682 (PSMA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5682 (PSMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 5682
NCBI-ProteinID: NP_002777
OMIM: 602854
HGNC: 9530
Ensembl: ENSG00000129084
Vega: OTTHUMG00000165825
Pharos: P25786(Tclin)
UniProt: P25786
Structure
PDB: 

Position
11p15.2
AA seq 263 aa AA seqDB search
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaaatcagtatgacaatgatgtcactgtttggagcccccagggcaggattcat
caaattgaatatgcaatggaagctgttaaacaaggttcagccacagttggtctgaaatca
aaaactcatgcagttttggttgcattgaaaagggcgcaatcagagcttgcagctcatcag
aaaaaaattctccatgttgacaaccatattggtatctcaattgcggggcttactgctgat
gctagactgttatgtaattttatgcgtcaggagtgtttggattccagatttgtattcgat
agaccactgcctgtgtctcgtcttgtatctctaattggaagcaagacccagataccaaca
caacgatatggccggagaccatatggtgttggtctccttattgctggttatgatgatatg
ggccctcacattttccaaacctgtccatctgctaactattttgactgcagagccatgtcc
attggagcccgttcccaatcagctcgtacttacttggagagacatatgtctgaatttatg
gagtgtaatttaaatgaactagttaaacatggtctgcgtgccttaagagagacgcttcct
gcagaacaggacctgactacaaagaatgtttccattggaattgttggtaaagacttggag
tttacaatctatgatgatgatgatgtgtctccattcctggaaggtcttgaagaaagacca
cagagaaaggcacagcctgctcaacctgctgatgaacctgcagaaaaggctgatgaacca
atggaacattaa

DBGET integrated database retrieval system