KEGG   Homo sapiens (human): 5684Help
Entry
5684              CDS       T01001                                 

Gene name
PSMA3, HC8, PSC3
Definition
(RefSeq) proteasome 20S subunit alpha 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5684 (PSMA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5684 (PSMA3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5684 (PSMA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5684 (PSMA3)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5684 (PSMA3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5684 (PSMA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 5684
NCBI-ProteinID: NP_002779
OMIM: 176843
HGNC: 9532
Ensembl: ENSG00000100567
Vega: OTTHUMG00000140319
Pharos: P25788(Tbio)
UniProt: P25788 A0A140VK43
Structure
PDB: 

Position
14q23.1
AA seq 255 aa AA seqDB search
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaatcggcactgggtatgacctgtcagcctctacattctctcctgacggaaga
gtttttcaagttgaatatgctatgaaggctgtggaaaatagtagtacagctattggaatc
agatgcaaagatggtgttgtctttggggtagaaaaattagtcctttctaaactttatgaa
gaaggttccaacaaaagactttttaatgttgatcggcatgttggaatggcagtagcaggt
ttgttggcagatgctcgttctttagcagacatagcaagagaagaagcttccaacttcaga
tctaactttggctacaacattccactaaaacatcttgcagacagagtggccatgtatgtg
catgcatatacactctacagtgctgttagaccttttggctgcagtttcatgttagggtct
tacagtgtgaatgacggtgcgcaactctacatgattgacccatcaggtgtttcatacggt
tattggggctgtgccatcggcaaagccaggcaagctgcaaagacggaaatagagaagctt
cagatgaaagaaatgacctgccgtgatatcgttaaagaagttgcaaaaataatttacata
gtacatgacgaagttaaggataaagcttttgaactagaactcagctgggttggtgaatta
actaatggaagacatgaaattgttccaaaagatataagagaagaagcagagaaatatgct
aaggaatctctgaaggaagaagatgaatcagatgatgataatatgtaa

DBGET integrated database retrieval system