KEGG   Homo sapiens (human): 56848Help
Entry
56848             CDS       T01001                                 

Gene name
SPHK2, SK_2, SK-2, SPK_2, SPK-2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05152  Tuberculosis
Module
hsa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    56848 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    56848 (SPHK2)
   04371 Apelin signaling pathway
    56848 (SPHK2)
   04020 Calcium signaling pathway
    56848 (SPHK2)
   04072 Phospholipase D signaling pathway
    56848 (SPHK2)
   04071 Sphingolipid signaling pathway
    56848 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    56848 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    56848 (SPHK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     56848 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 56848
NCBI-ProteinID: NP_001191088
OMIM: 607092
HGNC: 18859
Ensembl: ENSG00000063176
Vega: OTTHUMG00000183318
Pharos: Q9NRA0(Tchem)
UniProt: Q9NRA0 A0A024QZH5
Position
19q13.33
AA seq 654 aa AA seqDB search
MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaagcagaggagcagcaggaccagaggccagaccaggagctgacc
gggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcc
cgaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcggctgcgc
cccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggccg
ccccggttgcttctattggtcaatccctttgggggtcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgggatggc
atcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgc
cctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcgggcaac
gcgctggccggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctg
ttgctcaactgctcactgttgctgtgccggggtggtggccacccactggacctgctctcc
gtgacgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtg
tcagatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactg
ggcacggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctcccc
gccactgtggaacctgcctcgcccacccctgcccatagcctgcctcgtgccaagtcggag
ctgaccctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtg
tctgacctgcctcttcccctgccccagcctgccctggcctctcctggctcgccagaaccc
ctgcccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggct
ggggatgctccgctgtccccggacccactgctgtcttcacctcctggctctcccaaggca
gctctacactcacccgtctccgaaggggcccccgtaattcccccatcctctgggctccca
cttcccacccctgatgcccgggtaggggcctccacctgcggcccgcccgaccacctgctg
cctccgctgggcaccccgctgcccccagactgggtgacgctggagggggactttgtgctc
atgttggccatctcgcccagccacctaggcgctgacctggtggcagctccgcatgcgcgc
ttcgacgacggcctggtgcacctgtgctgggtgcgtagcggcatctcgcgggctgcgctg
ctgcgccttttcttggccatggagcgtggtagccacttcagcctgggctgtccgcagctg
ggctacgccgcggcccgtgccttccgcctagagccgctcacaccacgcggcgtgctcaca
gtggacggggagcaggtggagtatgggccgctacaggcacagatgcaccctggcatcggt
acactgctcactgggcctcctggctgcccggggcgggagccctga

DBGET integrated database retrieval system