KEGG   Homo sapiens (human): 56852
Entry
56852             CDS       T01001                                 

Gene name
RAD18, RNF73
Definition
(RefSeq) RAD18 E3 ubiquitin protein ligase
  KO
K10627  E3 ubiquitin-protein ligase RAD18 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    56852 (RAD18)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    56852 (RAD18)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     56852 (RAD18)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    56852 (RAD18)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    56852 (RAD18)
SSDB
Motif
Pfam: SAP zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_6 zf-RING_2 zf-RING_5 zf-WRNIP1_ubi zf-CpG_bind_C zf-rbx1 zf-RING_UBOX PhoU_div LEM SAP_new25 zf-RING_10 Rad50_zn_hook
Other DBs
NCBI-GeneID: 56852
NCBI-ProteinID: NP_064550
OMIM: 605256
HGNC: 18278
Ensembl: ENSG00000070950
Vega: OTTHUMG00000090545
Pharos: Q9NS91(Tbio)
UniProt: Q9NS91
Structure
PDB: 
2Y43 2YBF 5VF0 2MRE 2MRF

Position
3p25.3
AA seq 495 aa
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPV
ASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAP
DPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKR
KPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI
VREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKG
YKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREED
SSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRA
AESAEIEPRNKRNRN
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggactccctggccgagtctcggtggcctccgggcctggcagtcatgaagacaatagat
gatttgctgcggtgtggaatttgcttcgagtatttcaacattgcaatgataatacctcag
tgttcacataactactgctctctctgtataagaaaatttctgtcctataaaactcagtgt
ccaacttgctgtgtgactgtcacagagccggatctgaaaaataaccgcatattagatgaa
ctggtaaaaagcttgaattttgcacggaatcatctgctgcagtttgctttagagtcacca
gccaaatctcctgcttcttcctcttcaaagaatcttgctgtcaaagtatatactcctgta
gcctccagacagtctttaaagcaggggagcaggttaatggataatttcttgatcagagaa
atgagtggttctacatcagagttgttgataaaagaaaataaaagcaaattcagccctcaa
aaagaggcgagccctgctgcaaagaccaaagagacacgttctgtagaagagatcgctcca
gatccctcagaggctaagcgtcctgagccaccctcgacatccactttgaaacaagttact
aaagtggattgtcctgtttgcggggttaacattccagaaagtcacattaataagcattta
gacagctgtttatcacgcgaagagaagaaggaaagcctcagaagttctgttcacaaaagg
aagccgctgcccaaaactgtatataatttgctctctgatcgtgatttaaagaaaaagcta
aaagagcatggattatctattcaaggaaataaacaacagctcattaaaaggcaccaagaa
tttgtacacatgtacaatgcccaatgcgatgctttgcatcctaaatcagctgctgaaata
gttcgagaaatcgaaaatatagagaagactaggatgcgtcttgaagctagtaaactcaat
gaaagtgtaatggtttttacaaaggaccaaacagaaaaggaaatagatgaaatccacagt
aaatatcgtaaaaaacataagagtgaatttcagcttctggtggatcaggctagaaaagga
tacaagaaaattgctggaatgtcacaaaaaacagtaacaataacaaaagaagatgaatct
acagaaaagctatcttctgtatgcatgggacaggaagataatatgacctcagtaacaaac
cacttttctcaatcaaagctggactccccagaggaattggaacctgacagagaagaggat
tcttctagctgtattgatattcaagaagttctttcttcatcagaatcagattcatgcaat
agttccagttcagacatcataagagatcttttagaagaagaggaagcctgggaagcatca
cataaaaacgatcttcaagacacagaaataagtccaagacagaatcgccgcacaagagcc
gctgaaagtgctgagattgaaccaagaaacaagcgtaataggaattaa

DBGET integrated database retrieval system