KEGG   Homo sapiens (human): 56853Help
Entry
56853             CDS       T01001                                 

Gene name
CELF4, BRUNOL4, CELF-4
Definition
(RefSeq) CUGBP Elav-like family member 4
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    56853 (CELF4)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    56853 (CELF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 RRM_5 TF_Otx
Motif
Other DBs
NCBI-GeneID: 56853
NCBI-ProteinID: NP_064565
OMIM: 612679
HGNC: 14015
Ensembl: ENSG00000101489
Vega: OTTHUMG00000178178
Pharos: Q9BZC1(Tbio)
UniProt: Q9BZC1
Structure
PDB: 

Position
18q12.2
AA seq 486 aa AA seqDB search
MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQ
IPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKT
LPGMNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEE
CTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRR
MQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVAQGGYLNPMAAFAAAQMQQMA
ALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFAN
GIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEG
CNLFIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK
DANRPY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtatataaagatggccacgttagcaaacggacaggctgacaacgcaagcctcagtacc
aacgggctcggcagcagcccgggcagtgccgggcacatgaacggattaagccacagcccg
gggaacccgtcgaccattcccatgaaggaccacgatgccatcaagctgttcattgggcag
atcccccgcaacctggatgagaaggacctcaagcccctcttcgaggagtttggcaaaatc
tacgagcttacggttctgaaggacaggttcacaggcatgcacaaaggctgcgccttcctc
acctactgcgagcgtgagtcagcgctgaaggcccagagcgcgctgcacgagcagaagact
ctgcccgggatgaaccggccgatccaggtgaagcctgcggacagcgagagccgaggaggt
agtagctgcctgcgccagcccccttcacaagatagaaaactcttcgtgggcatgctcaac
aagcaacagtccgaggacgacgtgcgccgccttttcgaggcctttgggaacatcgaggag
tgcaccatcctgcgcgggcccgacggcaacagcaaggggtgcgcctttgtgaagtactcc
tcccacgccgaggcgcaggccgccatcaacgcgctacacggcagccagaccatgccggga
gcctcgtccagtctggtggtcaagttcgccgacaccgacaaggagcgcacgatgcggcga
atgcagcagatggctggccagatgggcatgttcaaccccatggccatccctttcggggcc
tacggcgcctacgctcaggcactgatgcagcagcaagcggccctgatggcatcagtcgcg
cagggcggctacctgaaccccatggctgccttcgctgccgcccagatgcagcagatggcg
gccctcaacatgaatggcctggcggccgcacctatgaccccaacctcaggtggcagcacc
cctccgggcatcactgcaccagccgtgcctagcatcccatcccccattggggtgaatggc
ttcaccggcctccccccacaggccaatgggcaacctgctgcggaagctgtgttcgccaat
ggcatccacccctacccagcacagagccccaccgccgcggaccccctgcagcaggcctac
gccggagtgcagcagtatgcaggtccagctgcctaccctgctgcctatggtcagataagc
caggcctttcctcagccgcctccaatgatcccccagcagcagagagaagggcccgagggc
tgtaacctgttcatctaccatctgccccaggagtttggggacgctgagctgatgcagatg
ttcctccctttcggcttcgtgagcttcgacaacccggccagcgcgcagaccgccatccag
gccatgaacggcttccagatcggcatgaagaggctcaaggtgcagctgaagcggcccaaa
gacgccaatcgcccgtactga

DBGET integrated database retrieval system