KEGG   Homo sapiens (human): 5686Help
Entry
5686              CDS       T01001                                 

Gene name
PSMA5, PSC5, ZETA
Definition
(RefSeq) proteasome 20S subunit alpha 5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5686 (PSMA5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5686 (PSMA5)
   05012 Parkinson disease
    5686 (PSMA5)
   05016 Huntington disease
    5686 (PSMA5)
   05017 Spinocerebellar ataxia
    5686 (PSMA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5686 (PSMA5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5686 (PSMA5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5686 (PSMA5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5686 (PSMA5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5686 (PSMA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 5686
NCBI-ProteinID: NP_002781
OMIM: 176844
HGNC: 9534
Ensembl: ENSG00000143106
Vega: OTTHUMG00000012001
Pharos: P28066(Tbio)
UniProt: P28066 A0A109NGN6
Structure
PDB: 

Position
1p13.3
AA seq 241 aa AA seqDB search
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttacccggtctgagtacgacaggggcgtgaatactttttctcccgaaggaaga
ttatttcaagtggaatatgccattgaggctatcaagcttggttctacagccattgggatc
cagacatcagagggtgtgtgcctagctgtggagaagagaattacttccccactgatggag
cccagcagcattgagaaaattgtagagattgatgctcacataggttgtgccatgagtggg
ctaattgctgatgctaagactttaattgataaagccagagtggagacacagaaccactgg
ttcacctacaatgagacaatgacagtggagagtgtgacccaagctgtgtccaatctggct
ttgcagtttggagaagaagatgcagatccaggtgccatgtctcgtccctttggagtagca
ttattatttggaggagttgatgagaaaggaccccagctgtttcatatggacccatctggg
acctttgtacagtgtgatgctcgagcaattggctctgcttcagagggtgcccagagctcc
ttgcaagaagtttaccacaagtctatgactttgaaagaagccatcaagtcttcactcatc
atcctcaaacaagtaatggaggagaagctgaatgcaacaaacattgagctagccacagtg
cagcctggccagaatttccacatgttcacaaaggaagaacttgaagaggttatcaaggac
atttaa

DBGET integrated database retrieval system