KEGG   Homo sapiens (human): 5687
Entry
5687              CDS       T01001                                 

Gene name
PSMA6, IOTA, PROS27, p27K
Definition
(RefSeq) proteasome 20S subunit alpha 6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5687 (PSMA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5687 (PSMA6)
   05012 Parkinson disease
    5687 (PSMA6)
   05016 Huntington disease
    5687 (PSMA6)
   05017 Spinocerebellar ataxia
    5687 (PSMA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5687 (PSMA6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5687 (PSMA6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5687 (PSMA6)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5687 (PSMA6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5687 (PSMA6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5687
NCBI-ProteinID: NP_002782
OMIM: 602855
HGNC: 9535
Ensembl: ENSG00000100902
Vega: OTTHUMG00000140221
Pharos: P60900(Tbio)
UniProt: P60900 A0A140VK44
Structure
PDB: 

Position
14q13.2
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccgtggttccagcgccggttttgaccgccacattaccattttttcacccgagggt
cggctctaccaagtagaatatgcttttaaggctattaaccagggtggccttacatcagta
gctgtcagagggaaagactgtgcagtaattgtcacacagaagaaagtacctgacaaatta
ttggattccagcacagtgactcacttattcaagataactgaaaacattggttgtgtgatg
accggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaac
tggaaatacaagtatggctatgagattcctgtggacatgctgtgtaaaagaattgccgat
atttctcaggtctacacacagaatgctgaaatgaggcctcttggttgttgtatgatttta
attggtatagatgaagagcaaggccctcaggtatataagtgtgatcctgcaggttactac
tgtgggtttaaagccactgcagcgggagttaaacaaactgagtcaaccagcttccttgaa
aaaaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattaca
tgcctgtctactgttctatcaattgatttcaaaccttcagaaatagaagttggagtagtg
acagttgaaaatcctaaattcaggattcttacagaagcagagattgatgctcaccttgtt
gctctagcagagagagactaa

DBGET integrated database retrieval system