KEGG   Homo sapiens (human): 56884
Entry
56884             CDS       T01001                                 
Symbol
FSTL5
Name
(RefSeq) follistatin like 5
  KO
K23915  follistatin-related protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    56884 (FSTL5)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    56884 (FSTL5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I1: Kazal family
   56884 (FSTL5)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   56884 (FSTL5)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set Kazal_2 Kazal_1 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 C1-set
Other DBs
NCBI-GeneID: 56884
NCBI-ProteinID: NP_064501
HGNC: 21386
Ensembl: ENSG00000168843
Pharos: Q8N475(Tdark)
UniProt: Q8N475
Position
4:complement(161383897..162164000)
AA seq 847 aa
MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDG
PFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACL
KKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLV
DQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYR
AFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDF
GDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDD
FFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY
YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQY
ITIRGEIQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIK
SLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT
VIWVGDA
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgtttaagtgctggtcagttgtcttggttctcggattcatttttctggagtcggaagga
aggccaaccaaagaaggaggatatggccttaaatcctatcagcctctaatgagattgcga
cataagcaggaaaaaaatcaagaaagttcaagagtcaaaggatttatgattcaggatggc
ccttttggatcttgtgaaaataagtactgtggtttgggaagacactgtgttaccagcaga
gagacagggcaagcagaatgtgcctgtatggacctttgcaaacgtcactacaaacctgtg
tgtggatctgacggagaattctatgaaaaccactgtgaagtgcacagagctgcttgcctg
aaaaaacaaaagattaccattgttcacaatgaagactgcttctttaaaggagataagtgc
aagactactgaatacagcaagatgaaaaatatgctattagatttacaaaatcaaaaatat
attatgcaagaaaatgaaaatcctaatggcgacgacatatctcggaagaagctattggtg
gatcaaatgtttaaatattttgatgcagacagtaatggacttgtagatattaatgaacta
actcaggtgataaaacaggaagaacttggcaaggatctctttgattgtactttgtatgtt
ctattgaaatatgatgattttaatgctgacaagcacctggctcttgaagaattttataga
gcattccaagtgatccagttgagtctgccagaagatcagaaactaagcatcactgcagca
actgtgggacaaagtgctgttctgagctgtgccattcaaggaaccctgagacctcccatt
atctggaaaaggaacaatattattctaaataatttagatttggaagacatcaatgacttt
ggagatgatgggtccttgtatattactaaggttaccacaactcacgttggcaattacacc
tgctatgcagatggctatgaacaagtctatcagactcacatcttccaagtgaatgttcct
ccagtcatccgggtgtatccagagagtcaggctagagagcctggggtaactgccagtctt
aggtgccatgcagagggcataccaaagcctcagcttggctggttgaagaatggaattgat
attacaccaaagctttccaaacaactcacgcttcaagcaaatggcagtgaggttcacata
agcaatgtgcgctatgaagatactggagcatacacttgtatcgcaaagaatgaagcagga
gtggatgaagacatctcttctctttttgtggaagactctgctagaaagaccctagctaac
atattatggagagaagaaggtctgggaattgggaacatgttctatgttttttatgaagat
ggaatcaaagtgatacaacccatagaatgtgaatttcagaggcacattaagcctagtgaa
aagctccttggatttcaggatgaagtctgtcccaaagctgagggagatgaagttcagagg
tgtgtgtgggcatcagctgttaatgtcaaagacaagttcatttatgttgcacagccaact
ttggacagagtccttattgttgatgtgcagtcccaaaaagttgttcaggcagtgagcaca
gaccctgtcccagttaaattacactatgacaaatcacatgatcaggtctgggtgctaagc
tggggtaccttggagaagacatcaccaacactacaggtaattaccctggccagtgggaat
gtgcctcaccacacgatccacacccaaccagtgggaaagcaatttgacagagtggatgat
tttttcattcccaccacaacactcattatcacccatatgaggtttggatttattcttcat
aaagatgaagctgcactacaaaaaattgatcttgaaaccatgtcatacatcaagacaatt
aacttgaaggactataagtgcgttcctcagtcattggcatatacacacttgggaggctac
tacttcattggctgcaaacctgacagcaccggagcagtttccccacaggtcatggtggac
ggtgtaactgactcagtcattgggttcaatagtgatgtgacgggcactccatatgtctct
ccagatggccactaccttgtcagcattaatgatgtgaaaggtcttgtaagggttcagtac
attaccatcagaggagaaatacaggaggcttttgatatttacacaaatctgcacatatct
gatctggcatttcaaccatcctttactgaagcccaccaatataacatctacggtagttca
agcacacaaactgatgtgctctttgtggagctctcttctgggaaggtcaagatgataaag
agtctcaaggaaccactcaaggcagaagaatggccttggaaccggaaaaacaggcaaatc
caggacagtggcttgtttggtcaatacctgatgacaccttccaaggactctctcttcatc
ctagatggacgactcaataaattaaactgtgagatcactgaagttgaaaaaggaaataca
gtcatttgggttggagatgcctaa

DBGET integrated database retrieval system