KEGG   Homo sapiens (human): 5689
Entry
5689              CDS       T01001                                 

Gene name
PSMB1, HC5, PMSB1, PSC5
Definition
(RefSeq) proteasome 20S subunit beta 1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Drug target
Delanzomib: D10110
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5689 (PSMB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5689 (PSMB1)
   05012 Parkinson disease
    5689 (PSMB1)
   05016 Huntington disease
    5689 (PSMB1)
   05017 Spinocerebellar ataxia
    5689 (PSMB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5689 (PSMB1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5689 (PSMB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5689 (PSMB1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5689 (PSMB1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5689 (PSMB1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 5689
NCBI-ProteinID: NP_002784
OMIM: 602017
HGNC: 9537
Ensembl: ENSG00000008018
Vega: OTTHUMG00000016087
Pharos: P20618(Tclin)
UniProt: P20618 A0A140VK45
Structure
PDB: 

Position
6q27
AA seq 241 aa
MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML
STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQ
VGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttgtcctctacagccatgtattcggctcctggcagagacttggggatggaaccgcac
agagccgcgggccctttgcagctgcgattttcgccctacgttttcaacggaggtactata
ctggcaattgctggagaagattttgcaattgttgcttctgatactcgattgagtgaaggg
ttttcaattcatacgcgggatagccccaaatgttacaaattaacagacaaaacagtcatt
ggatgcagcggttttcatggagactgtcttacgctgacaaagattattgaagcaagacta
aagatgtataagcattccaataataaggccatgactacgggggcaattgctgcaatgctg
tctacaatcctgtattcaaggcgcttctttccatactatgtttacaacatcatcggtgga
cttgatgaagaaggaaagggggctgtatacagctttgatccagtagggtcttaccagaga
gactccttcaaggctggaggctcagcaagtgccatgctacagcccctgcttgacaaccag
gttggttttaagaacatgcagaatgtggagcatgttccgctgtccttggacagagccatg
cggctggtgaaagatgtcttcatttctgcggctgagagagatgtgtacactggggacgca
ctccggatctgcatagtgaccaaagagggcatcagggaggaaactgtttccttaaggaag
gactga

DBGET integrated database retrieval system