KEGG   Homo sapiens (human): 56895Help
Entry
56895             CDS       T01001                                 

Gene name
AGPAT4, 1-AGPAT4, LPAAT-delta, dJ473J16.2
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 4
  KO
K13523  lysophosphatidic acid acyltransferase / lysophosphatidylinositol acyltransferase [EC:2.3.1.51 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    56895 (AGPAT4)
   00564 Glycerophospholipid metabolism
    56895 (AGPAT4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    56895 (AGPAT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    56895 (AGPAT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     56895 (AGPAT4)
    2.3.1.-  
     56895 (AGPAT4)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   56895 (AGPAT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransf_C Acyltransferase
Motif
Other DBs
NCBI-GeneID: 56895
NCBI-ProteinID: NP_064518
OMIM: 614795
HGNC: 20885
Ensembl: ENSG00000026652
Vega: OTTHUMG00000015966
Pharos: Q9NRZ5(Tbio)
UniProt: Q9NRZ5
Position
6q26
AA seq 378 aa AA seqDB search
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQ
LVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKV
LAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRF
TEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTL
LGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV
PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTE
IDKGSAYGNSDSKQKLND
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcgggactgctgaagtctcagttcctgtgccacctggtcttctgctacgtc
tttattgcctcagggctaatcatcaacaccattcagctcttcactctcctcctctggccc
attaacaagcagctcttccggaagatcaactgcagactgtcctattgcatctcaagccag
ctggtgatgctgctggagtggtggtcgggcacggaatgcaccatcttcacggacccgcgc
gcctacctcaagtatgggaaggaaaatgccatcgtggttctcaaccacaagtttgaaatt
gactttctgtgtggctggagcctgtccgaacgctttgggctgttagggggctccaaggtc
ctggccaagaaagagctggcctatgtcccaattatcggctggatgtggtacttcaccgag
atggtcttctgttcgcgcaagtgggagcaggatcgcaagacggttgccaccagtttgcag
cacctccgggactaccccgagaagtattttttcctgattcactgtgagggcacacggttc
acggagaagaagcatgagatcagcatgcaggtggcccgggccaaggggctgcctcgcctc
aagcatcacctgttgccacgaaccaagggcttcgccatcaccgtgaggagcttgagaaat
gtagtttcagctgtatatgactgtacactcaatttcagaaataatgaaaatccaacactg
ctgggagtcctaaacggaaagaaataccatgcagatttgtatgttaggaggatcccactg
gaagacatccctgaagacgatgacgagtgctcggcctggctgcacaagctctaccaggag
aaggatgcctttcaggaggagtactacaggacgggcaccttcccagagacgcccatggtg
cccccccggcggccctggaccctcgtgaactggctgttttgggcctcgctggtgctctac
cctttcttccagttcctggtcagcatgatcaggagcgggtcttccctgacgctggccagc
ttcatcctcgtcttctttgtggcctccgtgggagttcgatggatgattggtgtgacggaa
attgacaagggctctgcctacggcaactctgacagcaagcagaaactgaatgactga

DBGET integrated database retrieval system