KEGG   Homo sapiens (human): 56896
Entry
56896             CDS       T01001                                 

Gene name
DPYSL5, CRAM, CRMP-5, CRMP5, CV2, Ulip6
Definition
(RefSeq) dihydropyrimidinase like 5
  KO
K07529  dihydropyrimidinase-like 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    56896 (DPYSL5)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 56896
NCBI-ProteinID: NP_001240652
OMIM: 608383
HGNC: 20637
Ensembl: ENSG00000157851
Vega: OTTHUMG00000097071
Pharos: Q9BPU6(Tbio)
UniProt: Q9BPU6
Structure
PDB: 
4B91 4B90 4B92

Position
2p23.3
AA seq 564 aa
MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIP
GGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLA
DPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHA
CKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTH
CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPL
RLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWE
RGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ
GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREK
TLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQI
DDHVPKRASARILAPPGGRSSGIW
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgcttgccaactcagccagcgtgaggatcctcatcaagggaggcaaggtggtgaacgat
gactgcacccacgaggctgacgtctacatcgagaatggcatcatccagcaggtgggccgc
gagctcatgatccctggcggggccaaggtgattgatgccacaggaaaactggtgatccct
ggtggcatcgacaccagcacccacttccaccagaccttcatgaatgccacgtgcgtggac
gacttctaccatgggaccaaggcagcactcgtcggaggcaccaccatgatcatcggccac
gtcctgcccgacaaggagacctcccttgtggacgcttatgagaagtgccgaggtctggcc
gaccccaaggtctgctgtgattacgccctccacgtggggatcacctggtgggcacccaag
gtgaaagcagaaatggagacactggtgagggagaagggtgtcaactcgttccagatgttc
atgacctacaaggacctgtacatgcttcgagacagtgagctgtaccaagtgttgcacgct
tgcaaggacattggggcaatcgcccgcgtccatgctgaaaatggggagcttgtggccgag
ggtgctaaggaggcactggatttggggatcacaggcccagaaggaatcgagatcagccgt
ccagaggagctggaagctgaagccactcatcgtgttatcaccattgcaaacaggactcac
tgtccaatctacctggtcaacgtgtccagtatctcggctggtgacgttatcgcagctgct
aagatgcaagggaaggttgtgctggcggagaccaccactgcacatgccacgctgacaggc
ttacactactaccaccaggactggtcccacgcggctgcctatgtcacggtgcctcccctg
agactggacaccaacacctcaacctacctcatgagcctgctggccaatgacactctgaac
atcgtggcatcagatcaccggcctttcaccacaaagcagaaagctatgggcaaggaagac
ttcaccaagatcccacatggagtgagtggcgtgcaggaccgcatgagcgtcatctgggag
agaggagtggttggaggaaagatggatgagaaccgttttgtggccgttaccagttccaac
gcagctaagcttctgaacctgtatccccgcaagggccgcattattcccggagccgatgct
gatgtggtggtgtgggacccagaagccacaaagaccatctcagccagcacgcaggtccag
ggaggagacttcaacctgtatgagaacatgcgctgccacggcgtgccactggtcaccatc
agccgggggcgcgtcgtgtatgagaacggcgtcttcatgtgcgccgagggcaccggcaag
ttctgtcccctgaggtccttcccagacactgtctacaagaagctggtccagagagagaag
actttaaaggttagaggagtggaccgcactccctacctgggggatgtcgctgttgtcgtg
caccctgggaaaaaagagatgggaaccccactcgcagacactcctacccggcccgtcacc
cggcatgggggcatgagggaccttcacgaatccagcttcagcctctctggctctcagatc
gatgaccatgttccaaagcgagcttcagctcggatcctcgctcctcccggaggcaggtcg
agtggcatttggtaa

DBGET integrated database retrieval system