KEGG   Homo sapiens (human): 56898
Entry
56898             CDS       T01001                                 
Symbol
BDH2, DHRS6, EFA6R, PRO20933, SDR15C1, UCPA-OR, UNQ6308
Name
(RefSeq) 3-hydroxybutyrate dehydrogenase 2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    56898 (BDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     56898 (BDH2)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR ADH_zinc_N AlaDh_PNT_C Sacchrp_dh_NADP UDPG_MGDP_dh_N 3HCDH_N DUF1776 NAD_binding_10 DUF2325 FtsJ
Other DBs
NCBI-GeneID: 56898
NCBI-ProteinID: NP_064524
HGNC: 32389
Ensembl: ENSG00000164039
Pharos: Q9BUT1(Tbio)
UniProt: Q9BUT1
Structure
Position
4:complement(103077592..103099834)
AA seq 245 aa
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaagtcatcatcctgacggccgctgctcaggggattggccaa
gcagctgccttagcttttgcaagagaaggtgccaaagtcatagccacagacattaatgag
tccaaacttcaggaactggaaaagtacccgggtattcaaactcgtgtccttgatgtcaca
aagaagaaacaaattgatcagtttgccaatgaagttgagagacttgatgttctctttaat
gttgctggttttgtccatcatggaactgtcctggattgtgaggagaaagactgggacttc
tcgatgaatctcaatgtgcgcagcatgtacctgatgatcaaggcattccttcctaaaatg
cttgctcagaaatctggcaatattatcaacatgtcttctgtggcttccagcgtcaaagga
gttgtgaacagatgtgtgtacagcacaaccaaggcagccgtgattggcctcacaaaatct
gtggctgcagatttcatccagcagggcatcaggtgcaactgtgtgtgcccaggaacagtt
gatacgccatctctacaagaaagaatacaagccagaggaaatcctgaagaggcacggaat
gatttcctgaagagacaaaagacgggaagattcgcaactgcagaagaaatagccatgctc
tgcgtgtatttggcttctgatgaatctgcttatgtaactggtaaccctgtcatcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system