KEGG   Homo sapiens (human): 5690Help
Entry
5690              CDS       T01001                                 

Gene name
PSMB2, HC7-I
Definition
(RefSeq) proteasome subunit beta 2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Module
hsa_M00337  Immunoproteasome
hsa_M00340  Proteasome, 20S core particle
Drug target
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5690 (PSMB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5690 (PSMB2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5690 (PSMB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5690 (PSMB2)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T1: proteasome family
   5690 (PSMB2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5690 (PSMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-GeneID: 5690
NCBI-ProteinID: NP_002785
OMIM: 602175
HGNC: 9539
Ensembl: ENSG00000126067
Vega: OTTHUMG00000004169
Pharos: P49721(Tclin)
UniProt: P49721 A0A140VJS6
Structure
PDB: 

Position
1p34.3
AA seq 201 aa AA seqDB search
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggagtacctcatcggtatccaaggccccgactatgttcttgtcgcctccgaccgggtg
gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa
aagatattactcctgtgtgttggagaggctggagacactgtacagtttgcagaatatatt
cagaaaaacgtgcaactttataagatgcgaaatggatatgaattgtctcccacggcagca
gctaacttcacacgccgaaacctggctgactgtcttcggagtcggaccccatatcatgtg
aacctcctcctggctggctatgatgagcatgaagggccagcgctgtattacatggactac
ctggcagccttggccaaggccccttttgcagcccacggctatggtgccttcctgactctc
agtatcctcgaccgatactacacaccgactatctcacgtgagagggcagtggaactcctt
aggaaatgtctggaggagctccagaaacgcttcatcctgaatctgccaaccttcagtgtt
cgaatcattgacaaaaatggcatccatgacctggataacatttccttccccaaacagggc
tcctaa

DBGET integrated database retrieval system