KEGG   Homo sapiens (human): 5690
Entry
5690              CDS       T01001                                 

Gene name
PSMB2, HC7-I
Definition
(RefSeq) proteasome 20S subunit beta 2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Drug target
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5690 (PSMB2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5690 (PSMB2)
   05012 Parkinson disease
    5690 (PSMB2)
   05014 Amyotrophic lateral sclerosis
    5690 (PSMB2)
   05016 Huntington disease
    5690 (PSMB2)
   05017 Spinocerebellar ataxia
    5690 (PSMB2)
   05020 Prion disease
    5690 (PSMB2)
   05022 Pathways of neurodegeneration - multiple diseases
    5690 (PSMB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5690 (PSMB2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5690 (PSMB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5690 (PSMB2)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5690 (PSMB2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5690 (PSMB2)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 5690
NCBI-ProteinID: NP_002785
OMIM: 602175
HGNC: 9539
Ensembl: ENSG00000126067
Vega: OTTHUMG00000004169
Pharos: P49721(Tclin)
UniProt: P49721 A0A140VJS6
Structure
PDB: 

Position
1p34.3
AA seq 201 aa
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagtacctcatcggtatccaaggccccgactatgttcttgtcgcctccgaccgggtg
gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa
aagatattactcctgtgtgttggagaggctggagacactgtacagtttgcagaatatatt
cagaaaaacgtgcaactttataagatgcgaaatggatatgaattgtctcccacggcagca
gctaacttcacacgccgaaacctggctgactgtcttcggagtcggaccccatatcatgtg
aacctcctcctggctggctatgatgagcatgaagggccagcgctgtattacatggactac
ctggcagccttggccaaggccccttttgcagcccacggctatggtgccttcctgactctc
agtatcctcgaccgatactacacaccgactatctcacgtgagagggcagtggaactcctt
aggaaatgtctggaggagctccagaaacgcttcatcctgaatctgccaaccttcagtgtt
cgaatcattgacaaaaatggcatccatgacctggataacatttccttccccaaacagggc
tcctaa

DBGET integrated database retrieval system