KEGG   Homo sapiens (human): 56901Help
Entry
56901             CDS       T01001                                 

Gene name
NDUFA4L2, NUOMS
Definition
(RefSeq) NDUFA4, mitochondrial complex associated like 2
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    56901 (NDUFA4L2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    56901 (NDUFA4L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    56901 (NDUFA4L2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    56901 (NDUFA4L2)
   05012 Parkinson disease
    56901 (NDUFA4L2)
   05016 Huntington disease
    56901 (NDUFA4L2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    56901 (NDUFA4L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B12D
Motif
Other DBs
NCBI-GeneID: 56901
NCBI-ProteinID: NP_064527
HGNC: 29836
Ensembl: ENSG00000185633
Vega: OTTHUMG00000171275
Pharos: Q9NRX3(Tclin)
UniProt: Q9NRX3 A0A024RB39
Position
12q13.3
AA seq 87 aa AA seqDB search
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWN
RLSPNDQYKFLAVSTDYKKLKKDRPDF
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagccagtcttggggcccgcttctaccggcagatcaaaagacatccggggatc
atcccgatgatcggcttaatctgcctgggcatgggcagcgctgcgctttacttgctgcga
ctcgcccttcgcagccccgacgtctgctgggacagaaagaacaacccggagccctggaac
cgcctgagccccaatgaccaatacaagttccttgcagtttccactgactataagaagctg
aagaaggaccggccagacttctaa

DBGET integrated database retrieval system