KEGG   Homo sapiens (human): 56902Help
Entry
56902             CDS       T01001                                 

Gene name
PNO1, KHRBP1, RRP20
Definition
(RefSeq) partner of NOB1 homolog
  KO
K11884  RNA-binding protein PNO1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    56902 (PNO1)
   03051 Proteasome [BR:hsa03051]
    56902 (PNO1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    56902 (PNO1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    56902 (PNO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_8 KH_1
Motif
Other DBs
NCBI-GeneID: 56902
NCBI-ProteinID: NP_064528
HGNC: 32790
Ensembl: ENSG00000115946
Vega: OTTHUMG00000129563
Pharos: Q9NRX1(Tdark)
UniProt: Q9NRX1
Structure
PDB: 

Position
2p14
AA seq 252 aa AA seqDB search
MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVF
PPLCGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRT
CKETKDVSALTKAADFVKAFILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAI
GRIAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGN
IRAVASRSADRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgaaatggaaacgcagagcgccagggcagaggagggctttacccaggtcacc
cgcaagggtggccgacgggcgaagaaacgacaggctgaacagctgtccgcagcaggagag
ggcggggatgcgggccgcatggacacagaggaggccaggccggcgaagaggcccgtcttc
ccacccctctgtggggacgggctcctgagtgggaaagaagaaacaaggaaaattccagtc
ccagctaacagatacacaccattgaaagaaaactggatgaagatatttactcctattgtg
gaacatttgggacttcagatacgctttaacttgaaatcaaggaatgtagaaatcaggact
tgtaaagaaaccaaggatgttagtgctctgacaaaagcagctgattttgtgaaagctttt
attctcggctttcaggtggaggatgcacttgccctcatcaggttggatgacctcttccta
gagtcttttgaaattacagatgttaaacccctaaagggagaccatctatccagggcaata
ggaagaatcgctggcaaaggaggaaaaaccaaattcaccatagagaatgtgacacggaca
aggatagttttggctgatgtgaaagttcacatccttggctccttccaaaatatcaagatg
gcaagaactgccatttgcaacctaatcttgggaaatcctccttccaaggtttatggcaat
attcgagctgtggctagcagatcagcagatcgattctga

DBGET integrated database retrieval system