KEGG   Homo sapiens (human): 56903Help
Entry
56903             CDS       T01001                                 

Gene name
PAPOLB, PAPT, TPAP
Definition
(RefSeq) poly(A) polymerase beta
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    56903 (PAPOLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    56903 (PAPOLB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     56903 (PAPOLB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     56903 (PAPOLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2
Motif
Other DBs
NCBI-GeneID: 56903
NCBI-ProteinID: NP_064529
OMIM: 607436
HGNC: 15970
Ensembl: ENSG00000218823
Vega: OTTHUMG00000151759
Pharos: Q9NRJ5(Tbio)
UniProt: Q9NRJ5 A4D1Z6
Position
7p22.1
AA seq 637 aa AA seqDB search
MMPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQRLIETLRPFGVFEEEEELQ
RRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCV
APSHVDRSDFFTSFYAKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIP
EDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKCHNIYSN
ILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPV
WDPRVNPSDRYHLMPIITPAYPQQNSTYNVSISTRMVMIEEFKQGLAITHEILLSKAEWS
KLFEAPSFFQKYKHYIVLLASASTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQ
SFPAPKENPDMEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM
GMKITAMHLRRKELHQLLPHHVLQDKKAHSTEGRRLTDLNDSSFDLSAGCENSMSVPSST
STMKTGPLISSSQGRNSPALAVMTASVANIQATEFSLQQVNTNESSGVALNESIPHAVSQ
PAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtttccggtgacaacccagggaccaccgcagccggcgccgccgccgaatcgc
tacggcgtctcctcgcctatcagtctagcggtccccaaggagacggactgcctcctcacc
cagaggctaatagaaaccctcaggcccttcggggtcttcgaagaggaagaggaactgcag
cgcaggattttagttttggaaaaattaaataatctggtaaaggaatggatacgcgaaatc
agtgaaagcaagagtcttccccagtctgtaattgaaaacgttggaggaaagatttttacg
tttggctcttacagattaggagtacatacgaaaggcgcagatattgacgccttgtgcgtt
gcaccaagtcatgtggatcgaagcgactttttcacctcattctatgctaaactgaaacta
caggaggaagtgaaagatttaagggctgtcgaggaggcatttgtgccagttatcaaactg
tgttttgatgggatagagattgatattttatttgcaagattagcactacagactattcca
gaagatttggacttaagagatgacagtctacttaaaaatttagacattagatgcataaga
agccttaatggttgccgggtaaccgatgaaattttacatctagtgccaaacattgacaac
ttcaggctgactctgagagccatcaaactgtgggccaagtgccacaatatctattccaat
atattaggtttcctcggaggtgtttcctgggccatgctagtagcaagaacttgtcagctt
tatccaaatgcagtagcgtcaactcttgtacggaaattcttcttggtattttcagaatgg
gaatggccaaacccagtgttactgaaggagcctgaagaacggaatcttaatttgcctgta
tgggacccaagagtaaatcccagtgataggtaccatcttatgcctatcatcacaccagca
tacccacagcagaactccacatacaacgtgtctatttcaaccaggatggtcatgattgag
gagtttaaacaggggcttgctatcacacacgagattttgctaagtaaggcagagtggtcc
aaactctttgaagctccaagcttctttcaaaagtacaagcattatattgtacttctggca
agtgcatcaacagaaaaacaacatttagaatgggtgggcttggtggaatcaaagatccga
atcctggttgggagcttggagaagaatgaatttattacactggcacatgtgaatccacag
tcatttccagcacccaaagaaaatcctgatatggaagaatttcgtacaatgtgggtgatt
gggttagggctaaaaaagccagataattctgaaattctcagcattgatctcacctatgat
atccagtctttcacagatactgtttataggcaagcagtgaatagtaagatgtttgagatg
ggtatgaaaattactgcaatgcatttaagaagaaaggaacttcaccagctgctgcctcat
catgtgcttcaggacaagaaagcacactcaacagaaggtagaagattgacagatttgaac
gacagcagctttgacttgtctgcaggctgtgaaaacagcatgtctgtgccttcatctact
agcactatgaagacaggcccattgattagcagttctcagggtagaaacagtcctgccttg
gctgtaatgacagcatctgtggctaacatacaggctactgaattttccttgcaacaggtg
aataccaatgaaagttcaggggttgcattaaacgaaagtattcctcacgctgtctctcag
cctgccatttctccatcaccaaaggccatggtcgccagagttgtttcttcaacatgtctc
ataagccatccagaccttcaggaaactcagcaacaaacatatctaatcctatag

DBGET integrated database retrieval system