KEGG   Homo sapiens (human): 56907
Entry
56907             CDS       T01001                                 

Symbol
SPIRE1, Spir-1
Name
(RefSeq) spire type actin nucleation factor 1
  KO
K02098  spire
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KIND FYVE
Other DBs
NCBI-GeneID: 56907
NCBI-ProteinID: NP_001122098
OMIM: 609216
HGNC: 30622
Ensembl: ENSG00000134278
Vega: OTTHUMG00000153940
Pharos: Q08AE8(Tbio)
UniProt: Q08AE8
Structure
PDB: 
2YLE 2YLF 3R7G 3RBW

Position
18p11.21
AA seq 756 aa
MAQAAGPAGGGEPRTEAVGGEGPREPGAAGGAAGGSRDALSLEEILRLYNQPINEEQAWA
VCYQCCGSLRAAARRRQPRHRVRSAAQIRVWRDGAVTLAPAADDAGEPPPVAGKLGYSQC
METEVIESLGIIIYKALDYGLKENEERELSPPLEQLIDHMANTVEADGSNDEGYEAAEEG
LGDEDEKRKISAIRSYRDVMKLCAAHLPTESDAPNHYQAVCRALFAETMELHTFLTKIKS
AKENLKKIQEMEKSDESSTDLEELKNADWARFWVQVMRDLRNGVKLKKVQERQYNPLPIE
YQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLKKSAHEIILDFIRSRPPLNPVSARKLK
PTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLAMRPLSMSYSFDLSDVTTPESTKN
LVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHKSTSSSS
VSPSFPEEPVLEAVSTRKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSR
QSSRSLEEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDIYTALKKGKLCFCCRTR
RFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPST
AHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSL
VLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggctcaggcggctggcccggcgggcggcggggagccgcggactgaggcagtgggcggc
gaggggccgcgggagcccggggcagccggcggcgcggccgggggctcccgggacgcgctg
agcctggaggagatcctgcggctgtacaaccagcccatcaacgaggagcaggcgtgggcc
gtgtgctaccagtgctgcggttccctgcgcgccgccgcccgccgccgccagccccgccac
cgtgtgcgctcggccgcgcagatccgcgtctggagggacggcgccgtcaccctggcgccc
gcggccgacgacgcgggagagccgcccccagttgcgggtaaattgggatattcacaatgt
atggaaacagaggtcattgaatctttgggaattattatttataaagcactggactatggt
ttgaaggagaatgaagaaagggaattaagccctcccctagagcagcttatcgatcacatg
gccaacacggtggaagctgacggtagcaatgatgagggctatgaggctgcagaagaaggc
ctgggagatgaagatgaaaagagaaaaatctcagctattcggtcatatagagatgtcatg
aagttgtgtgctgctcatctccctactgaatcagatgcaccaaatcattatcaggcagta
tgtcgtgcactgtttgcagaaacaatggagctccatacatttctgaccaaaattaagagt
gcgaaagagaatcttaagaagattcaagaaatggaaaagagcgatgaatctagcacagac
ttggaagagctgaaaaacgctgactgggcacgattctgggtacaggtgatgagggatttg
aggaatggggtaaaacttaagaaggtccaagagcggcagtacaaccctttgcccattgaa
tatcagctcaccccttatgagatgttaatggatgacattcgctgcaaaagatacaccttg
cgaaaagtgatggtgaatggtgatattccccctcggttaaaaaagagtgctcatgaaatc
atcctcgacttcatcagatccagacctcctttaaatccagtctcagccagaaaactgaaa
ccaactccaccacggccacggagcctccatgaaagaatattagaagaaattaaagcagaa
agaaagctgcggcctgtatcaccagaggagattagacgtagcagattagcaatgcggcca
cttagcatgtcttacagttttgacttgtcagatgtgactacccctgaatctacaaagaat
cttgtggagtcatctatggtgaatggaggtttgacatcacaaacaaaagaaaacgggtta
agtacctcacagcaggtgcctgcacagcggaagaagctcctcagagccccaactctggcc
gaactggacagctctgagtctgaggaagaaacgctgcacaagtcgaccagcagcagcagc
gtgtctccctctttccctgaagagccagtcctggaggccgtgtccacaaggaagaagcct
ccaaaattcctgcccatatcatcaacaccccagccagagagacggcagccaccccagaga
cgacattccattgaaaaggaaacgcctactaacgtgaggcagttcctgccgccttccagg
cagagttcccgctctcttgaggaattctgctacccagtggaatgcctcgctcttactgtg
gaagaagtgatgcatattcgccaggtcctggtgaaggcagagctggaaaaataccaacag
tataaagacatctacaccgccttgaaaaaaggaaagctctgcttttgttgccgaaccagg
aggttttccttcttcacttggtcttatacctgtcagttctgtaagaggccggtgtgctca
cagtgttgcaaaaagatgcggctgccctccaaaccatactccactcttcctatcttttca
ttgggaccttctgctctgcaaagaggggaaagtagtatgaggtcagaaaaaccctccact
gcccatcatcggccacttcggagcattgccaggttctcctcaaaatctaagtctatggac
aaatcagatgaagaactccagtttcccaaagagttgatggaggactggagcaccatggag
gtgtgtgtggactgcaagaagttcatttcggaaatcatcagttcaagccggcgcagtctg
gtgttggccaacaaaagggcccgattgaaaaggaaaacgcagtctttctacatgtcctcg
ccaggcccctcggagtactgcccttcagagaggacgatcagtgagatctga

KEGG   Homo sapiens (human): 84501
Entry
84501             CDS       T01001                                 

Symbol
SPIRE2, Spir-2
Name
(RefSeq) spire type actin nucleation factor 2
  KO
K02098  spire
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KIND PrmA Thymosin
Other DBs
NCBI-GeneID: 84501
NCBI-ProteinID: NP_115827
OMIM: 609217
HGNC: 30623
Ensembl: ENSG00000204991
Vega: OTTHUMG00000173039
Pharos: Q8WWL2(Tdark)
UniProt: Q8WWL2
Structure
PDB: 
5JCY

Position
16q24.3
AA seq 714 aa
MARAGSCGGAAAGAGRPEPWELSLEEVLKAYEQPLNEEQAWAVCFQGCRGLRGSPGRRLR
DTGDLLLRGDGSVGAREPEAAEPATMVVPLASSEAQTVQSLGFAIYRALDWGLDESEERE
LSPQLERLIDLMANNDSEDSGCGAADEGYGGPEEEEEAEGVPRSVRTFAQAMRLCAARLT
DPRGAQAHYQAVCRALFVETLELRAFLARVREAKEMLQKLREDEPHLETPRAELDSLGHT
DWARLWVQLMRELRRGVKLKKVQEQEFNPLPTEFQLTPFEMLMQDIRARNYKLRKVMVDG
DIPPRVKKDAHELILDFIRSRPPLKQVSERRLRPLPPKQRSLHEKILEEIKQERRLRPVR
GEGWAARGFGSLPCILNACSGDAKSTSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEM
NTSEEEESPCGEVTLKRDRSFSEHDLAQLRSEVASGLQSATHPPGGTEPPRPRAGSAHVW
RPGSRDQGTCPASVSDPSHPLLSNRGSSGDRPEASMTPDAKHLWLEFSHPVESLALTVEE
VMDVRRVLVKAEMEKFLQNKELFSSLKKGKICCCCRAKFPLFSWPPSCLFCKRAVCTSCS
IKMKMPSKKFGHIPVYTLGFESPQRVSAAKTAPIQRRDIFQSLQGPQWQSVEEAFPHIYS
HGCVLKDVCSECTSFVADVVRSSRKSVDVLNTTPRRSRQTQSLYIPNTRTLDFK
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggcccgggcgggcagctgcggcggcgccgcggcgggcgcagggcggccggagccctgg
gagctgtccctggaggaggtgctgaaggcctacgagcagccgctcaacgaggagcaggcg
tgggccgtgtgcttccagggctgccgcgggctgcggggctcgccgggccggcgcctgcgg
gataccggggacctcctgctgcgcggggacggctcggtcggggcgcgggagcccgaggcc
gcggaacctgcaaccatggtcgtgccactagccagctcggaagcccagaccgtgcagtcc
ctcggcttcgccatctaccgcgcgctggactgggggctggacgagagcgaggagcgcgaa
ctcagccctcagctggagcggctcatcgacctcatggccaacaacgacagcgaggacagc
ggctgcggtgccgccgatgagggctacgggggtcccgaggaggaggaggaggccgagggc
gtcccccgcagcgtgcgcacctttgcccaggccatgcggctgtgcgcggcgcggctgacc
gacccccggggcgcacaggcgcattaccaggccgtgtgccgcgcgctcttcgtggagacg
ctggagctgcgggccttcctggccagggtccgggaggccaaggagatgctgcagaagctt
cgggaggacgagccgcatctggagacgcctcgggcagagctggacagcctgggtcacaca
gactgggcccgactgtgggttcagctcatgcgggagctccgccgcggagtgaagctgaag
aaggtgcaagagcaggagttcaaccccctccccaccgagttccagctcacgcccttcgag
atgctgatgcaggacatccgggcccggaactacaagctgcgcaaggtcatggtggatggg
gacatcccgccccgggtgaagaaggacgctcacgagctcatcctggactttatccgctca
cggcctccactgaagcaggtctctgagaggcggctgcgcccgttgccaccaaagcaaagg
tccctgcatgagaagatcctggaggagatcaagcaggagcggaggctgcgcccggtgcgg
ggcgagggctgggctgcccgcgggtttggctctctgccctgcatcctcaacgcctgctcc
ggagatgccaagtccacctcctgcatcaacctgtcagtcacagatgctgggggcagcgcc
cagcgcccgcggccccgcgtgctgctcaaggcgcctaccttggctgaaatggaagagatg
aatacatctgaggaagaagagtctccgtgtggggaggtgacgctgaaacgggaccgctcc
ttctcagagcatgacctggcccagctccgaagtgaggtggcctctggcctgcagtcggcc
acccaccccccaggagggacggagccaccacggccccgagctggcagtgcgcatgtgtgg
aggcccggctcccgagaccagggtacctgtcccgcgagtgtctctgaccccagccacccc
ctactcagcaaccggggctcctcgggggacagacccgaggcctccatgacccccgatgcc
aaacacctgtggctggagttcagccaccccgtggagagcctggcgctgactgtggaagag
gtgatggacgtgcgccgtgtgctggtgaaggccgagatggaaaagtttttgcagaacaag
gagctcttcagcagtctgaagaaggggaagatttgctgctgctgccgggccaagttcccg
ctgttctcgtggccgcccagctgtctcttctgcaagagagccgtctgcacttcctgtagc
ataaagatgaagatgccttctaagaaatttggacacatccctgtctacacactgggcttt
gagagtcctcagagggtatcagctgccaaaaccgcgccaatccagagaagagacatcttt
cagtctctgcaagggccacagtggcagagcgtggaggaggcgttcccccacatctactcc
cacggctgtgtcctgaaggatgtctgcagtgagtgcaccagctttgtggcagacgtggtg
cgttccagccgcaagagcgtggacgtcctcaacactacgccacgacgcagtcgccagacc
caatccctctacatccctaacaccaggactcttgacttcaagtga

DBGET integrated database retrieval system