KEGG   Homo sapiens (human): 56912Help
Entry
56912             CDS       T01001                                 

Gene name
IFT46, C11orf2, C11orf60, CFAP32
Definition
(RefSeq) intraflagellar transport 46
  KO
K19682  intraflagellar transport protein 46
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    56912 (IFT46)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    56912 (IFT46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFT46_B_C
Motif
Other DBs
NCBI-GeneID: 56912
NCBI-ProteinID: NP_001162089
HGNC: 26146
Ensembl: ENSG00000118096
Vega: OTTHUMG00000166408
Pharos: Q9NQC8(Tdark)
UniProt: Q9NQC8
Position
11q23.3
AA seq 304 aa AA seqDB search
MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPL
EGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVP
RPDGKPDNLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAID
TWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDCSLAEYI
DMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKAFTPSSNSTSQAGDMET
LTFS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctgataacagcagtgatgagtgtgaagaggaaaataacaaggagaagaagaagacc
tcacagttgacacctcaacggggctttagtgaaaatgaggatgacgatgatgatgatgat
gattcatctgaaactgattctgattctgatgatgatgatgaagagcatggagcccctctg
gaaggggcctatgaccctgcagactatgagcatttgccagtttctgctgaaattaaggaa
ctcttccagtacatcagtaggtacacacctcagttgattgacctggaccacaaactgaag
cctttcattcctgattttatcccagctgtcggggatattgatgcattcttaaaggtccca
cgtcctgatggaaagcctgacaaccttggcctattggtattggatgaaccttctacaaag
cagtcagaccctacggtgctctcactctggttaacagagaattctaagcagcacaacatc
acacaacatatgaaagtaaaaagcctagaagatgcagaaaagaatcccaaagccattgac
acgtggattgagagcatctctgaattacaccgttctaagccccctgcgactgtgcactac
accaggcccatgcccgacattgacacgctgatgcaggaatggtccccggagtttgaagag
cttttgggcaaggtaagcctgcccacggcagagattgattgcagcctggcagagtacatt
gacatgatctgtgccattctagacatccctgtctacaagagtcggatccagtccctccat
ctgctcttttccctctactcagaattcaagaactcacagcattttaaagctctcgctgaa
ggcaagaaagcattcactccttcatccaattccacctcccaagctggagacatggagaca
ttaaccttcagctga

DBGET integrated database retrieval system