KEGG   Homo sapiens (human): 56915Help
Entry
56915             CDS       T01001                                 

Gene name
EXOSC5, RRP41B, RRP46, Rrp46p, hRrp46p, p12B
Definition
(RefSeq) exosome component 5
  KO
K12590  exosome complex component RRP46
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Module
hsa_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    56915 (EXOSC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    56915 (EXOSC5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     56915 (EXOSC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 56915
NCBI-ProteinID: NP_064543
OMIM: 606492
HGNC: 24662
Ensembl: ENSG00000077348
Vega: OTTHUMG00000182759
Pharos: Q9NQT4(Tbio)
UniProt: Q9NQT4
Structure
PDB: 

Position
19q13.2
AA seq 235 aa AA seqDB search
MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYG
PAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVL
QVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAV
LTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagacgcatactgacgccaaaatccgtgctgaaaatggaacagggtccagc
cctcggggtcctggctgcagcctccggcactttgcctgcgaacagaacctgctgtcgcgg
ccagatggctctgcttccttcctgcaaggtgacacctctgtcctggcgggtgtgtacggg
ccggccgaggtgaaggtcagcaaagagattttcaacaaggccacactcgaagtgatcctg
aggccgaagattgggctgcctggtgttgcagagaagagccgggagcggctgatcaggaac
acgtgcgaggcggtggtgctgggcacgttgcacccccgcacctccatcaccgtggtgctg
caggttgtcagcgatgccggctctctcctggcctgttgtctgaatgccgcctgcatggca
ttggtggatgcaggtgtgcccatgcgggctctcttctgtggggtcgcctgcgccctggac
tctgatgggaccctcgtgctggatcctacatccaagcaagaaaaggaggcccgggcagtc
ctgacctttgccctggacagcgtggaacggaagctgctgatgtccagcaccaaggggctc
tactcagacactgagctccagcagtgcctggctgcggcccaggccgcttcgcaacacgtc
ttccgtttctaccgggaatcgctgcagaggcgttactccaagagctga

DBGET integrated database retrieval system