KEGG   Homo sapiens (human): 56923Help
Entry
56923             CDS       T01001                                 

Gene name
NMUR2, FM-4, FM4, NMU-R2, NMU2R, TGR-1, TGR1
Definition
(RefSeq) neuromedin U receptor 2
  KO
K05053  neuromedin U receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56923 (NMUR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    56923 (NMUR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuromedin U
    56923 (NMUR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw IRK Rab5ip Ceramidase
Motif
Other DBs
NCBI-GeneID: 56923
NCBI-ProteinID: NP_064552
OMIM: 605108
HGNC: 16454
Ensembl: ENSG00000132911
Vega: OTTHUMG00000130131
Pharos: Q9GZQ4(Tchem)
UniProt: Q9GZQ4
Position
5q33.1
AA seq 415 aa AA seqDB search
MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV
IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY
FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP
NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA
LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES
LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA
QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggatggaaaaacttcagaatgcttcctggatctaccagcagaaactagaagat
ccattccagaaacacctgaacagcaccgaggagtatctggccttcctctgcggacctcgg
cgcagccacttcttcctccccgtgtctgtggtgtatgtgccaatttttgtggtgggggtc
attggcaatgtcctggtgtgcctggtgattctgcagcaccaggctatgaagacgcccacc
aactactacctcttcagcctggcggtctctgacctcctggtcctgctccttggaatgccc
ctggaggtctatgagatgtggcgcaactaccctttcttgttcgggcccgtgggctgctac
ttcaagacggccctctttgagaccgtgtgcttcgcctccatcctcagcatcaccaccgtc
agcgtggagcgctacgtggccatcctacacccgttccgcgccaaactgcagagcacccgg
cgccgggccctcaggatcctcggcatcgtctggggcttctccgtgctcttctccctgccc
aacaccagcatccatggcatcaagttccactacttccccaatgggtccctggtcccaggt
tcggccacctgtacggtcatcaagcccatgtggatctacaatttcatcatccaggtcacc
tccttcctattctacctcctccccatgactgtcatcagtgtcctctactacctcatggca
ctcagactaaagaaagacaaatctcttgaggcagatgaagggaatgcaaatattcaaaga
ccctgcagaaaatcagtcaacaagatgctgtttgtcttggtcttagtgtttgctatctgt
tgggccccgttccacattgaccgactcttcttcagctttgtggaggagtggagtgaatcc
ctggctgctgtgttcaacctcgtccatgtggtgtcaggtgtcttcttctacctgagctca
gctgtcaaccccattatctataacctactgtctcgccgcttccaggcagcattccagaat
gtgatctcttctttccacaaacagtggcactcccagcatgacccacagttgccacctgcc
cagcggaacatcttcctgacagaatgccactttgtggagctgaccgaagatataggtccc
caattcccatgtcagtcatccatgcacaactctcacctcccagcagccctctctagtgaa
cagatgtcaagaacaaactatcaaagcttccactttaacaaaacctga

DBGET integrated database retrieval system