KEGG   Homo sapiens (human): 5693Help
Entry
5693              CDS       T01001                                 

Gene name
PSMB5, LMPX, MB1, X
Definition
(RefSeq) proteasome 20S subunit beta 5
  KO
K02737  20S proteasome subunit beta 5 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Drug target
Bortezomib: D03150
Carfilzomib: D08880
Delanzomib: D10110
Ixazomib (DG01269): D10130 D10131
Marizomib: D09640
Oprozomib: D10318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5693 (PSMB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5693 (PSMB5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5693 (PSMB5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5693 (PSMB5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5693 (PSMB5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5693 (PSMB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome DUF3991
Motif
Other DBs
NCBI-GeneID: 5693
NCBI-ProteinID: NP_002788
OMIM: 600306
HGNC: 9542
Ensembl: ENSG00000100804
Vega: OTTHUMG00000028713
Pharos: P28074(Tclin)
UniProt: P28074
Structure
PDB: 

Position
14q11.2
AA seq 263 aa AA seqDB search
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgccagcgtgttggagagaccgctaccggtgaaccagcgcgggtttttcgga
cttgggggtcgtgcagatctgctggatctaggtccagggagtctcagtgatggtctgagc
ctggccgcgccaggctggggtgtcccagaagagccaggaatcgaaatgcttcatggaaca
accaccctggccttcaagttccgccatggagtcatagttgcagctgactccagggctaca
gcgggtgcttacattgcctcccagacggtgaagaaggtgatagagatcaacccatacctg
ctaggcaccatggctgggggcgcagcggattgcagcttctgggaacggctgttggctcgg
caatgtcgaatctatgagcttcgaaataaggaacgcatctctgtagcagctgcctccaaa
ctgcttgccaacatggtgtatcagtacaaaggcatggggctgtccatgggcaccatgatc
tgtggctgggataagagaggccctggcctctactacgtggacagtgaagggaaccggatt
tcaggggccaccttctctgtaggttctggctctgtgtatgcatatggggtcatggatcgg
ggctattcctatgacctggaagtggagcaggcctatgatctggcccgtcgagccatctac
caagccacctacagagatgcctactcaggaggtgcagtcaacctctaccacgtgcgggag
gatggctggatccgagtctccagtgacaatgtggctgatctacatgagaagtatagtggc
tctaccccctga

DBGET integrated database retrieval system