KEGG   Homo sapiens (human): 56944
Entry
56944             CDS       T01001                                 
Symbol
OLFML3, HNOEL-iso, OLF44
Name
(RefSeq) olfactomedin like 3
  KO
K25448  olfactomedin-like protein 1/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    56944 (OLFML3)
SSDB
Motif
Pfam: OLF ERM_helical MscS_porin TMF_TATA_bd DUF3287 FH2 Sec16 MAD
Other DBs
NCBI-GeneID: 56944
NCBI-ProteinID: NP_064575
OMIM: 610088
HGNC: 24956
Ensembl: ENSG00000116774
Pharos: Q9NRN5(Tdark)
UniProt: Q9NRN5 M1LAK4
Position
1:113979474..113982253
AA seq 406 aa
MGPSTPLLILFLLSWSGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKN
KMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTK
GKGRRNEKYDMVTDCGYTISQVRSMKILKRFGGPAGLWTKDPLGQTEKIYVLDGTQNDTA
FVFPRLRDFTLAMAARKASRVRVPFPWVGTGQLVYGGFLYFARRPPGRPGGGGEMENTLQ
LIKFHLANRTVVDSSVFPAEGLIPPYGLTADTYIDLAADEEGLWAVYATREDDRHLCLAK
LDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFDASGTLTPERA
ALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggggcccagcacccctctcctcatcttgttccttttgtcatggtcgggacccctccaa
ggacagcagcaccaccttgtggagtacatggaacgccgactagctgctttagaggaacgg
ctggcccagtgccaggaccagagtagtcggcatgctgctgagctgcgggacttcaagaac
aagatgctgccactgctggaggtggcagagaaggagcgggaggcactcagaactgaggcc
gacaccatctccgggagagtggatcgtctggagcgggaggtagactatctggagacccag
aacccagctctgccctgtgtagagtttgatgagaaggtgactggaggccctgggaccaaa
ggcaagggaagaaggaatgagaagtacgatatggtgacagactgtggctacacaatctct
caagtgagatcaatgaagattctgaagcgatttggtggcccagctggtctatggaccaag
gatccactggggcaaacagagaagatctacgtgttagatgggacacagaatgacacagcc
tttgtcttcccaaggctgcgtgacttcacccttgccatggctgcccggaaagcttcccga
gtccgggtgcccttcccctgggtaggcacagggcagctggtatatggtggctttctttat
tttgctcggaggcctcctggaagacctggtggaggtggtgagatggagaacactttgcag
ctaatcaaattccacctggcaaaccgaacagtggtggacagctcagtattcccagcagag
gggctgatccccccctacggcttgacagcagacacctacatcgacctggcagctgatgag
gaaggtctttgggctgtctatgccacccgggaggatgacaggcacttgtgtctggccaag
ttagatccacagacactggacacagagcagcagtgggacacaccatgtcccagagagaat
gctgaggctgcctttgtcatctgtgggaccctctatgtcgtctataacacccgtcctgcc
agtcgggcccgcatccagtgctcctttgatgccagcggcaccctgacccctgaacgggca
gcactcccttattttccccgcagatatggtgcccatgccagcctccgctataacccccga
gaacgccagctctatgcctgggatgatggctaccagattgtctataagctggagatgagg
aagaaagaggaggaggtttga

DBGET integrated database retrieval system