KEGG   Homo sapiens (human): 56947
Entry
56947             CDS       T01001                                 

Gene name
MFF, C2orf33, EMPF2, GL004
Definition
(RefSeq) mitochondrial fission factor
  KO
K22076  mitochondrial fission factor
Organism
hsa  Homo sapiens (human)
Disease
H01900  Encephalopathy due to defective mitochondrial and peroxisomal fission
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    56947 (MFF)
SSDB
Motif
Pfam: Miff
Other DBs
NCBI-GeneID: 56947
NCBI-ProteinID: NP_001263990
OMIM: 614785
HGNC: 24858
Ensembl: ENSG00000168958
Vega: OTTHUMG00000133180
Pharos: Q9GZY8(Tbio)
UniProt: Q9GZY8 A1MAC2
Position
2q36.3
AA seq 342 aa
MSKGTSSDTSLGRVSRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNA
DLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVL
TLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWHRSDSA
PRNKISRFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQ
QILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQI
IKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagtaaaggaacaagcagtgacacatcactaggaagggtgagcagggcagcatttcct
tctcccactgctgctgagatggcagaaattagtcgaattcagtacgaaatggaatatact
gaaggcattagtcagcgaatgagggtcccagaaaagttaaaagtagcaccgccaaacgct
gacctggaacaaggattccaagaaggagttccaaatgctagtgtgataatgcaagttccg
gagaggattgttgtagcaggaaataatgaagatgtttcattttcaagaccagcagatctt
gaccttattcagtcaactccctttaaacccctggcactgaaaacaccacctcgtgtactt
acgctgagtgaaagaccactagattttctggatttagaaagacctcctacaacccctcaa
aatgaagaaatccgagcagttggcagactaaaaagagagcggtctatgagtgaaaatgct
gttcgccaaaatggacagctggtcagaaatgattctctgtggcacagatcagattctgcc
ccaagaaataaaatttcaaggttccaggcaccgatttctgcaccggagtacactgtgaca
ccatcgccacaacaggctcgggtctgtcctccccatatgttacctgaagatggagctaat
ctttcctctgctcgtggcattttgtcgcttatccagtcttctactcgtagggcataccag
cagatcttggatgtgctggatgaaaatcgcagacctgtgttgcgtggtgggtctgctgcc
gccacttctaatcctcatcatgacaacgtcaggtatggcatttcaaatatagatacaacc
attgaaggaacgtcagatgacctgactgttgtagatgcagcttcactaagacgacagata
atcaaactaaatagacgtctacaacttctggaagaggagaacaaagaacgtgctaaaaga
gaaatggtcatgtattcaattactgtagctttctggctgcttaatagctggctctggttt
cgccgctag

DBGET integrated database retrieval system