KEGG   Homo sapiens (human): 5695Help
Entry
5695              CDS       T01001                                 

Gene name
PSMB7, Z
Definition
(RefSeq) proteasome subunit beta 7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5695 (PSMB7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5695 (PSMB7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5695 (PSMB7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5695 (PSMB7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5695 (PSMB7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5695 (PSMB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Pr_beta_C
Motif
Other DBs
NCBI-GeneID: 5695
NCBI-ProteinID: NP_002790
OMIM: 604030
HGNC: 9544
Ensembl: ENSG00000136930
Vega: OTTHUMG00000021042
Pharos: Q99436(Tbio)
UniProt: Q99436 E9KL30
Structure
PDB: 

Position
9q33.3
AA seq 277 aa AA seqDB search
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtatgctccaccagttggaggcttctcttttgataactgccgc
aggaatgccgtcttggaagccgattttgcaaagaggggatacaagcttccaaaggtccgg
aaaactggcacgaccatcgctggggtggtctataaggatggcatagttcttggagcagat
acaagagcaactgaagggatggttgttgctgacaagaactgttcaaaaatacacttcata
tctcctaatatttattgttgtggtgctgggacagctgcagacacagacatgacaacccag
ctcatttcttccaacctggagctccactccctctccactggccgtcttcccagagttgtg
acagccaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttagggggagtagatgttactggacctcacctctacagcatctatcctcatgga
tcaactgataagttgccttatgtcaccatgggttctggctccttggcagcaatggctgta
tttgaagataagtttaggccagacatggaggaggaggaagccaagaatctggtgagcgaa
gccatcgcagctggcatcttcaacgacctgggctccggaagcaacattgacctctgcgtc
atcagcaagaacaagctggattttctccgcccatacacagtgcccaacaagaaggggacc
aggcttggccggtacaggtgtgagaaagggactactgcagtcctcactgagaaaatcact
cctctggagattgaggtgctggaagaaacagtccaaacaatggacacttcctga

DBGET integrated database retrieval system