KEGG   Homo sapiens (human): 56954Help
Entry
56954             CDS       T01001                                 

Gene name
NIT2, HEL-S-8a
Definition
(RefSeq) nitrilase family member 2
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    56954 (NIT2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     56954 (NIT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 56954
NCBI-ProteinID: NP_064587
OMIM: 616769
HGNC: 29878
Ensembl: ENSG00000114021
Vega: OTTHUMG00000159066
Pharos: Q9NQR4(Tbio)
UniProt: Q9NQR4 V9HW91
Position
3q12.2
AA seq 276 aa AA seqDB search
MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEK
IPGESTQKLSEVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDV
PGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFN
LTTGPAHWELLQRSRAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEA
IVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacctctttccgcttggccctcatccagcttcagatttcttccatcaaatcagataac
gtcactcgcgcttgtagcttcatccgggaggcagcaacgcaaggagccaaaatagtttct
ttgccggaatgctttaattctccatatggagcgaaatattttcctgaatatgcagagaaa
attcctggtgaatccacacagaagctttctgaagtagcaaaggaatgcagcatatatctc
attggaggctctatccctgaagaggatgctgggaaattatataacacctgtgctgtgttt
gggcctgatggaactttactagcaaagtatagaaagatccatctgtttgacattgatgtt
cctggaaaaattacatttcaagaatctaaaacattgagtccgggtgatagtttctccaca
tttgatactccttactgcagagtgggtctgggcatctgctacgacatgcggtttgcagag
cttgcacaaatctacgcacagagaggctgccagctgttggtatatccaggagcttttaat
ctgaccactggaccagcccattgggagttacttcagcgaagccgggctgttgataatcag
gtgtatgtggccacagcctctcctgcccgggatgacaaagcctcctatgttgcctgggga
cacagcaccgtggtgaacccttggggggaggttctagccaaagctggcacagaagaagca
atcgtgtattcagacatagacctgaagaagctggctgaaatacgccagcaaatccccgtt
tttagacagaagcgatcagacctctatgctgtggagatgaaaaagccctaa

DBGET integrated database retrieval system