KEGG   Homo sapiens (human): 56955
Entry
56955             CDS       T01001                                 

Gene name
MEPE, OF45
Definition
(RefSeq) matrix extracellular phosphoglycoprotein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Osteoregulin
Other DBs
NCBI-GeneID: 56955
NCBI-ProteinID: NP_001171623
OMIM: 605912
HGNC: 13361
Ensembl: ENSG00000152595
Vega: OTTHUMG00000130592
Pharos: Q9NQ76(Tbio)
UniProt: Q9NQ76 Q8NC19 A0A024RDD1
Position
4q22.1
AA seq 525 aa
MRVFCVGLLLFSVTWAAPTFQPQTEKTKQSCVEEQRQEEKNKDNIGFHHLGKRINQELSS
KENIVQERKKDLSLSEASENKGSSKSQNYFTNRQRLNKEYSISNKENTHNGLRMSIYPKS
TGNKGFEDGDDAISKLHDQEEYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNII
PASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSG
YTDLQERGDNDISPFSGDGQPFKDIPGKGEATGPDLEGKDIQTGFAGPSEAESTHLDTKK
PGYNEIPEREENGGNTIGTRDETAKEADAVDVSLVEGSNDIMGSTNFKELPGREGNRVDA
GSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEIPKNGKGSTRKGVDHSNRNQAT
LNEKQRFPSKGKSQGLPIPSRGLDNEIKNEMDSFNGPSHENIITHGRKYHYVPHRQNNST
RNKGMPQGKGSWGRQPHSNRRFSSRRRDDSSESSDSGSSSESDGD
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcgagttttctgtgtgggactactccttttcagtgtgacctgggcagcaccaacattt
caaccacagactgagaaaactaagcaaagctgtgtggaagagcagaggcaggaagaaaaa
aacaaagacaatattggttttcaccatttgggcaagagaataaatcaagagctatcatct
aaagaaaatattgtccaggaaagaaagaaagatttgtccctttctgaagccagtgagaat
aagggaagtagtaaatctcaaaattatttcacaaatagacagagactgaataaagaatat
agtatcagtaacaaagagaatactcacaatggcctgaggatgtcaatttatcctaagtca
actgggaataaagggtttgaggatggagatgatgctatcagcaaactacatgaccaagaa
gaatatggcgcagctctcatcagaaataacatgcaacatataatggggccagtgactgcg
attaaactcctgggggaagaaaacaaagagaacacacctaggaatgttctaaacataatc
ccagcaagtatgaattatgctaaagcacactcgaaggataaaaagaagcctcaaagagat
tcccaagcccagaaaagtccagtaaaaagcaaaagcacccatcgtattcaacacaacatt
gactacctaaaacatctctcaaaagtcaaaaaaatccccagtgattttgaaggcagcggt
tatacagatcttcaagagagaggggacaatgatatatctcctttcagtggggacggccaa
ccttttaaggacattcctggtaaaggagaagctactggtcctgacctagaaggcaaagat
attcaaacagggtttgcaggcccaagtgaagctgagagtactcatcttgacacaaaaaag
ccaggttataatgagatcccagagagagaagaaaatggtggaaataccattggaactagg
gatgaaactgcgaaagaggcagatgctgttgatgtcagccttgtagagggcagcaacgat
atcatgggtagtaccaattttaaggagctccctggaagagaaggaaacagagtggatgct
ggcagccaaaatgctcaccaagggaaggttgagtttcattaccctcctgcaccctcaaaa
gagaaaagaaaagaaggcagtagtgatgcagctgaaagtaccaactataatgaaattcct
aaaaatggcaaaggcagtaccagaaagggtgtagatcattctaataggaaccaagcaacc
ttaaatgaaaaacaaaggtttcctagtaagggcaaaagtcagggcctgcccattccttct
cgtggtcttgataatgaaatcaaaaacgaaatggattcctttaatggccccagtcatgag
aatataataacacatggcagaaaatatcattatgtaccccacagacaaaataattctaca
cggaataagggtatgccacaagggaaaggctcctggggtagacaaccccattccaacagg
aggtttagttcccgtagaagggatgacagtagtgagtcatctgacagtggcagttcaagt
gagagcgatggtgactag

DBGET integrated database retrieval system